bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
1-acylglycerophosphocholine O-acyltransferase activity
(GO:0047184)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
LPCAT2 0 0.380 -0.210
LPCAT3 0 -1.220 1.200 0.300 0.355
LPCAT1 0 0.790 -0.740 0.844 0.107 0.289
LPCAT4 0 0.590 -0.440

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
LPCAT1 Ubiquitylation K191 -1.958 -0.654 _TVEEIK(gl)R_
LPCAT1 Ubiquitylation K221 -2.397 _TCLITFK(gl)PGAFIPGAPVQPVVLR_
LPCAT1 Ubiquitylation K347 -0.307 _GLGLKPEK(gl)_
LPCAT2 Ubiquitylation K204 0.014 _NTINEIIK(gl)R_
LPCAT3 Ubiquitylation K312 0.742 _AK(gl)WDACANMK_
LPCAT4 Phosphorylation S2 -1.886 _(ac)S(ph)QGSPGDWAPLDPTPGPPASPNPFVHELHLSR_


© Copyright Svejstrup Laboratory 2015