bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: HSPA1B

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
HSPA1B 0 1.432 0.650 -0.490
HSPA1B 0 1.432 0.650 -0.490 -0.230 -0.299 0.288
HSPA1B 0 1.432 0.650 -0.490 -0.052 -0.156 0.693
HSPA1B 0 1.432 0.980 -0.710
HSPA1B 0 1.432 0.980 -0.710 -0.230 -0.299 0.288
HSPA1B 0 1.432 0.980 -0.710 -0.052 -0.156 0.693

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
HSPA1B Ubiquitylation K293 0.429 0.774 _VQK(gl)LLQDFFDGRDLNK_
HSPA1B Ubiquitylation K415 0.350 0.416 _VQK(gl)LLQDFFNGR_
HSPA1B Ubiquitylation K144 -0.178 0.354 _K(gl)FGDPVVQSDMK_
HSPA1B Phosphorylation S430 -0.034 0.270 _DLNKS(ph)INPDEAVAYGAAVQAAILMGDK_
HSPA1B Ubiquitylation K606 -0.206 0.229 _VSAK(gl)NALESYAFNMK_
HSPA1B Ubiquitylation K579 -0.190 0.190 _LSK(gl)EEIER_
HSPA1B Ubiquitylation K193 0.228 0.185 _AFYPEEISSMVLTK(gl)MK_
HSPA1B Ubiquitylation K226 0.132 0.178 _QATK(gl)DAGVIAGLNVLR_
HSPA1B Ubiquitylation K518 -0.419 0.057 _AM(ox)TK(gl)DNNLLGR_
HSPA1B Ubiquitylation K593 -0.391 0.049 _YK(gl)AEDEVQR_
HSPA1B Ubiquitylation K195 0.037 -0.034 _AFYPEEISSM(ox)VLTKMK(gl)_
HSPA1B Ubiquitylation K386 -0.241 -0.092 _STLEPVEK(gl)ALR_
HSPA1B Ubiquitylation K452 -0.228 -0.104 _ITITNDK(gl)GR_
HSPA1B Ubiquitylation K574 -0.220 -0.136 _ITITNDK(gl)GR_
HSPA1B Ubiquitylation K175 -0.318 -0.211 _VQVSYK(gl)GETK_
HSPA1B Ubiquitylation K567 -0.274 -0.233 _ANK(gl)ITITNDK(gl)GR_
HSPA1B Ubiquitylation K591 -0.220 -0.249 _MVQEAEK(gl)YKAEDEVQR_
HSPA1B Ubiquitylation K123 -0.699 -0.482 _LIGDAAK(gl)NQVALNPQNTVFDAK(gl)R_
HSPA1B Ubiquitylation K179 -0.895 -0.675 _GETK(gl)AFYPEEISSMVLTK_
HSPA1B Ubiquitylation K138 -0.774 -1.004 _NQVALNPQNTVFDAK(gl)R_
HSPA1B Ubiquitylation K626 -2.032 -3.939 _SAVEDEGLK(gl)GK_
HSPA1B Ubiquitylation K564 0.473 _STGK(gl)ANK(gl)ITITNDK_
HSPA1B Ubiquitylation K628 -2.370 _SAVEDEGLKGK(gl)_
HSPA1B Ubiquitylation K664 -2.002 _K(gl)ELEQVCNPIISGLYQGAGGPGPGGFGAQGPK_

Background Information for HSPA1B:


Pubmed-HSPA1B »
Uniprot-HSPA1B »
Biogrid-HSPA1B »
ProteomicsDB-HSPA1B »

Tumorportal-HSPA1B »
COSMIC-HSPA1B »
GenomeRNAi-HSPA1B »
Genecards-HSPA1B


Protein-protein Interactions for HSPA1B
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait KLHL34 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SLC27A3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in HSPA1B
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members HSP70_C IPR029048 0.66
Category members HSP70_peptide-bd IPR029047 0.55
Category members MreB_Mrl IPR004753 0.4
Category members Hsp_70_fam IPR013126 0.4


Protein complexes (CORUM database) featuring HSPA1B
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Corum 116 Polycomb repressive complex 1 (PRC1, hPRC-H) Database 1.56
Category members Corum 115 Polycomb repressive complex 1 (PRC1, hPRC-H) Database 1.28
Category members Corum 725 P2X7 receptor signalling complex Database 0.53
Category members Corum 432 N-NOS-CHIP-HSP70-1 complex Database 0.47
Category members Corum 626 LSD1 complex Database 0.17


Categories featuring HSPA1B
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Pathway Pathway_371 REACTOME_INFLUENZA_LIFE_CYCLE 0 INF
Category members Pathway Pathway_771 REACTOME_METABOLISM_OF_RNA 0 INF
Category members Pathway Pathway_773 REACTOME_METABOLISM_OF_MRNA 0 INF
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005829 cytosol Database INF
Category members GO Category GO:0010467 gene expression Database INF
Category members GO Category GO:0016070 RNA metabolic process Database INF
Category members GO Category GO:0016071 mRNA metabolic process Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0030529 ribonucleoprotein complex Database 8.45
Category members Pathway Pathway_851 KEGG_SPLICEOSOME 0 7.94
Category members GO Category GO:0005524 ATP binding Database 5.54
Category members GO Category GO:0016607 nuclear speck Database 4.84
Category members GO Category GO:0051082 unfolded protein binding Database 3.74
Category members GO Category GO:0031625 ubiquitin protein ligase binding Database 2.54
Category members Pathway Pathway_781 REACTOME_REGULATION_OF_MRNA_STABILITY_BY_PROTEINS_THAT_BIND_AU_RICH_ELEMENTS 0 2.04
Category members GO Category GO:0047485 protein N-terminus binding Database 1.84
Category members GO Category GO:0005739 mitochondrion Database 1.67
Category members GO Category GO:0008180 COP9 signalosome Database 1.47
Category members Pathway Pathway_776 REACTOME_DESTABILIZATION_OF_MRNA_BY_AUF1_HNRNP_D0 0 1.45
Category members Pathway Pathway_666 KEGG_ENDOCYTOSIS 0 1.25
Category members GO Category GO:0001618 virus receptor activity Database 0.83
Category members GO Category GO:0042026 protein refolding Database 0.63
Category members GO Category GO:0005783 endoplasmic reticulum Database 0.62
Category members GO Category GO:0006986 response to unfolded protein Database 0.62
Category members GO Category GO:0043066 negative regulation of apoptotic process Database 0.6
Category members GO Category GO:0048471 perinuclear region of cytoplasm Database 0.39
Category members GO Category GO:0008285 negative regulation of cell proliferation Database 0.28
Category members GO Category GO:0045648 positive regulation of erythrocyte differentiation Database 0.23
Category members GO Category GO:0030308 negative regulation of cell growth Database 0.18
Category members GO Category GO:0016234 inclusion body Database 0.14
Category members GO Category GO:0003725 double-stranded RNA binding Database 0.1
Category members Pathway Pathway_767 KEGG_ANTIGEN_PROCESSING_AND_PRESENTATION 0 0.09
Category members GO Category GO:0006402 mRNA catabolic process Database 0.02
Category members Pathway Pathway_715 KEGG_MAPK_SIGNALING_PATHWAY 0 0
Category members GO Category GO:0000902 cell morphogenesis Database 0
Category members GO Category GO:0016235 aggresome Database 0
Category members GO Category GO:0044183 protein binding involved in protein folding Database 0


.

© Copyright Svejstrup Laboratory 2015