bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: ADD1

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
ADD1 0 2.209 0.440 0.020 -0.881 -0.757 1.191 -0.072

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
ADD1 Phosphorylation S586 -0.125 1.117 _QKGS(ph)EENLDEAR_
ADD1 Phosphorylation S726 0.518 0.668 _TPS(ph)FLKK_
ADD1 Phosphorylation S436 0.937 0.639 _KYSDVEVPASVTGYSFASDGDSGTCSPLRHS(ph)FQK_
ADD1 Ubiquitylation K140 0.386 _GSDSIAYDK(gl)GEK_
ADD1 Ubiquitylation K143 0.288 0.386 _GSDSIAYDKGEK(gl)_
ADD1 Phosphorylation S64 0.260 _RVSMILQS(ph)PAFCEELESMIQEQFK_
ADD1 Phosphorylation S431 -0.176 -0.145 _KYSDVEVPASVTGYSFASDGDSGTCS(ph)PLR_
ADD1 Phosphorylation S358 -0.346 -0.241 _SPGS(ph)PVGEGTGSPPK_
ADD1 Phosphorylation S353 -0.425 -0.286 _S(ph)RSPGSPVGEGTGSPPK_
ADD1 Phosphorylation S355 -0.007 -0.345 _SRS(ph)PGSPVGEGTGSPPK_
ADD1 Phosphorylation T11 -0.730 -0.576 _AAVVT(ph)SPPPTTAPHK_
ADD1 Phosphorylation S12 -1.409 -0.665 _AAVVTS(ph)PPPTTAPHK_
ADD1 Phosphorylation S366 -1.004 _SPGSPVGEGTGS(ph)PPKWQIGEQEFEALMR_
ADD1 Phosphorylation S483 -0.425 -1.128 _TSTS(ph)AVPNLFVPLNTNPK_
ADD1 Phosphorylation T429 -0.303 _YSDVEVPASVTGYSFASDGDSGT(ph)CSPLR_

Background Information for ADD1:


Pubmed-ADD1 »
Uniprot-ADD1 »
Biogrid-ADD1 »
ProteomicsDB-ADD1 »

Tumorportal-ADD1 »
COSMIC-ADD1 »
GenomeRNAi-ADD1 »
Genecards-ADD1


Protein-protein Interactions for ADD1
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait ADD1 Cat. description Hein, Mann, Cell 2015
Category members IP bait ATL2 Cat. description Hein, Mann, Cell 2015
Category members IP bait CAPZA2 Cat. description Hein, Mann, Cell 2015
Category members IP bait CDKN2AIP Cat. description Hein, Mann, Cell 2015
Category members IP bait CORO1C Cat. description Hein, Mann, Cell 2015
Category members IP bait IQGAP1 Cat. description Hein, Mann, Cell 2015
Category members IP bait LIMA1 Cat. description Hein, Mann, Cell 2015
Category members IP bait LRWD1 Cat. description Hein, Mann, Cell 2015
Category members IP bait MAPRE1 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYH9 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYO1C Cat. description Hein, Mann, Cell 2015
Category members IP bait NES Cat. description Hein, Mann, Cell 2015
Category members IP bait TMOD3 Cat. description Hein, Mann, Cell 2015
Category members IP bait TPM4 Cat. description Hein, Mann, Cell 2015
Category members IP bait ADD2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait ANKRD29 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait DPPA4 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait GBP2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in ADD1
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members Aldolase_II/adducin_N IPR001303 0.26


Protein complexes (CORUM database) featuring ADD1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring ADD1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members DDR Literature pubmedid:24332808 Marechal et al., 2014 RPA-mediated recruitment INF
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005829 cytosol Database INF
Category members GO Category GO:0044267 cellular protein metabolic process Database 10.42
Category members GO Category GO:0003779 actin binding Database 5.41
Category members DDR Literature pubmedid:19647519 Paulsen et al., 2009 siRNA screen for g-H2A.x phosphorylation 3.6
Category members GO Category GO:0006921 cellular component disassembly involved in execution phase of apoptosis Database 2.98
Category members Pathway Pathway_876 REACTOME_APOPTOTIC_EXECUTION_PHASE 0 2.5
Category members Pathway Pathway_837 REACTOME_APOPTOSIS 0 2.39
Category members GO Category GO:0006915 apoptotic process Database 2.12
Category members GO Category GO:0008290 F-actin capping protein complex Database 1.36
Category members GO Category GO:0030968 endoplasmic reticulum unfolded protein response Database 1.35
Category members GO Category GO:0006987 activation of signaling protein activity involved in unfolded protein response Database 1.26
Category members Pathway Pathway_877 REACTOME_APOPTOTIC_CLEAVAGE_OF_CELLULAR_PROTEINS 0 1.25
Category members GO Category GO:0005886 plasma membrane Database 1.21
Category members GO Category GO:0030507 spectrin binding Database 1.12
Category members Pathway Pathway_147 REACTOME_UNFOLDED_PROTEIN_RESPONSE 0 1.08
Category members GO Category GO:0030036 actin cytoskeleton organization Database 1.08
Category members GO Category GO:0051015 actin filament binding Database 0.99
Category members GO Category GO:0005198 structural molecule activity Database 0.94
Category members GO Category GO:0043197 dendritic spine Database 0.86
Category members GO Category GO:0005516 calmodulin binding Database 0.74
Category members GO Category GO:0005856 cytoskeleton Database 0.63
Category members GO Category GO:0016020 membrane Database 0.52
Category members GO Category GO:0051017 actin filament bundle assembly Database 0.47
Category members Pathway Pathway_146 REACTOME_DIABETES_PATHWAYS 0 0.39
Category members GO Category GO:0048471 perinuclear region of cytoplasm Database 0.39
Category members GO Category GO:0008134 transcription factor binding Database 0.37
Category members GO Category GO:0046982 protein heterodimerization activity Database 0.28
Category members GO Category GO:0030425 dendrite Database 0.26
Category members GO Category GO:0051016 barbed-end actin filament capping Database 0.21
Category members GO Category GO:0001701 in utero embryonic development Database 0.2
Category members GO Category GO:0045766 positive regulation of angiogenesis Database 0.19
Category members GO Category GO:0030218 erythrocyte differentiation Database 0.13
Category members GO Category GO:0030837 negative regulation of actin filament polymerization Database 0.13
Category members Pathway Pathway_1018 REACTOME_CASPASE_MEDIATED_CLEAVAGE_OF_CYTOSKELETAL_PROTEINS 0 0.11
Category members Pathway Pathway_148 REACTOME_ACTIVATION_OF_CHAPERONE_GENES_BY_XBP1S 0 0.11
Category members GO Category GO:0045202 synapse Database 0.06
Category members GO Category GO:0020027 hemoglobin metabolic process Database 0.04
Category members GO Category GO:0035264 multicellular organism growth Database 0.04
Category members GO Category GO:0048873 homeostasis of number of cells within a tissue Database 0.04
Category members GO Category GO:0000902 cell morphogenesis Database 0
Category members GO Category GO:0006884 cell volume homeostasis Database 0
Category members GO Category GO:0014069 postsynaptic density Database 0
Category members GO Category GO:0032092 positive regulation of protein binding Database 0
Category members GO Category GO:0042608 T cell receptor binding Database 0
Category members GO Category GO:0042803 protein homodimerization activity Database 0
Category members GO Category GO:0045807 positive regulation of endocytosis Database 0
Category members GO Category GO:0071300 cellular response to retinoic acid Database 0


.

© Copyright Svejstrup Laboratory 2015