bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
positive regulation of potassium ion transport
(GO:0043268)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
ACTN2 3 -1.480 2.640 0.936 1.929 -1.407 0.572 0.293
ACTN2 3 -1.480 2.640 0.790 0.055 0.246
FHL1 1 -0.670 -0.090 -0.060 -0.291 0.491 0.677 -0.269
DLG1 1 0.400 -0.220 1.552 0.102 0.488
HBP1 0 -1.130 1.580
ANK2 0 0.370 -0.920
KIF5B 0 -0.940 1.450
STK39 0 1.920 -1.010

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ACTN2 Ubiquitylation K125 1.906 _ALDFIASKGVK(gl)_
ACTN2 Ubiquitylation K350 0.585 _VQEK(gl)CQLEINFNTLQTK_
ACTN2 Ubiquitylation K417 0.789 _LDHLAEK(gl)FR_
ACTN2 Ubiquitylation K592 -0.644 0.678 _EAILAIHK(gl)EAQR_
ACTN2 Ubiquitylation K760 0.273 1.507 _DAK(gl)GISQEQMQEFR_
ANK2 Phosphorylation S1459 0.673 0.675 _ES(ph)ESDQEQEEEIDM(ox)TSEK_
ANK2 Phosphorylation S1461 0.678 0.687 _ESES(ph)DQEQEEEIDMTSEK_
ANK2 Phosphorylation S3793 0.342 0.385 _AMIVPSS(ph)PSK_
ANK2 Phosphorylation S3823 -0.465 -0.203 _GGS(ph)PIIQEPEEPSEHREESSPR_
ANK2 Phosphorylation T3844 0.389 _T(ph)SLVIVESADNQPETCER_
ANK2 Phosphorylation S3845 0.659 0.389 _KTS(ph)LVIVESADNQPETCER_
DLG1 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG1 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG1 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG1 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG1 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG1 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG1 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG1 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG1 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
FHL1 Ubiquitylation K131 0.708 2.028 _ILCNK(gl)CTTR_
HBP1 Ubiquitylation K426 -1.246 _NCGSPGSSQLSSNSLYAK(gl)AVK_
KIF5B Phosphorylation S933 -0.617 _PIRPGQHPAAS(ph)PTHPSAIR_
STK39 Phosphorylation S385 0.711 _TEDGDWEWS(ph)DDEMDEKSEEGK_


© Copyright Svejstrup Laboratory 2015