Results for the Category
activation of protein kinase B activity
(GO:0032148)
RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
W | |||||||
Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
---|---|---|---|---|---|---|---|---|
INSR | 2 | -0.850 | 0.830 | 1.143 | 0.785 | |||
CCDC88A | 1 | -0.320 | 0.670 | 0.250 | ||||
CCDC88A | 1 | -0.160 | -0.260 | 0.250 | ||||
PRKCZ | 0 | -0.290 | 0.310 | |||||
WNT5A | 0 | |||||||
PDPK1 | 0 | 0.050 | -0.440 | |||||
GAS6 | 0 | 0.020 | 0.220 | -1.517 | -0.502 |
Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
---|---|---|---|---|---|
CCDC88A | Phosphorylation | S1387 | -0.568 | _FYDPS(ph)PPR_ | |
CCDC88A | Phosphorylation | S1587 | 2.636 | _VHASRPAS(ph)LDSGR_ | |
CCDC88A | Phosphorylation | T1673 | 0.950 | 0.959 | _T(ph)GSPGSEVVTLQQFLEESNK_ |
CCDC88A | Phosphorylation | S1675 | 0.884 | 0.947 | _TGS(ph)PGSEVVTLQQFLEESNK_ |
CCDC88A | Phosphorylation | S1700 | 0.947 | _S(ph)SSQENLLDEVM(ox)K_ | |
CCDC88A | Phosphorylation | S1702 | 0.387 | 1.065 | _SSS(ph)QENLLDEVMK_ |
CCDC88A | Phosphorylation | S1820 | 0.228 | _RTS(ph)IHDFLTK_ | |
INSR | Ubiquitylation | K1022 | -0.603 | _EK(gl)ITLLR_ | |
INSR | Ubiquitylation | K1047 | 0.305 | 0.711 | _DIIK(gl)GEAETR_ |
INSR | Ubiquitylation | K1057 | 0.482 | 0.484 | _VAVK(gl)TVNESASLR_ |
INSR | Ubiquitylation | K1352 | 1.606 | 2.754 | _DGGSSLGFK(gl)R_ |
PDPK1 | Phosphorylation | S241 | 0.358 | 0.361 | _ANS(ph)FVGTAQYVSPELLTEK_ |
PDPK1 | Ubiquitylation | K257 | 0.571 | -0.234 | _ANSFVGTAQYVSPELLTEK(gl)SACK_ |
PRKCZ | Phosphorylation | T560 | -0.884 | -1.578 | _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_ |
WNT5A | Ubiquitylation | K268 | -0.304 | _VGDALK(gl)EK_ |
.
© Copyright Svejstrup Laboratory 2015