bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
potassium channel regulator activity
(GO:0015459)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
DLG1 1 0.400 -0.220 1.552 0.102 0.488
YWHAE 1 0.440 -0.380 1.095 -0.160
YWHAE 1 0.440 -0.380 1.129 0.621 0.321
NEDD4L 0 -0.050 -0.110
PRKCZ 0 -0.290 0.310
ARPP19 0 -0.400 0.120
ARPP19 0 -0.400 0.120
ANK2 0 0.370 -0.920
CHP1 0 0.130 0.190 -0.105 0.192

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ANK2 Phosphorylation S1459 0.673 0.675 _ES(ph)ESDQEQEEEIDM(ox)TSEK_
ANK2 Phosphorylation S1461 0.678 0.687 _ESES(ph)DQEQEEEIDMTSEK_
ANK2 Phosphorylation S3793 0.342 0.385 _AMIVPSS(ph)PSK_
ANK2 Phosphorylation S3823 -0.465 -0.203 _GGS(ph)PIIQEPEEPSEHREESSPR_
ANK2 Phosphorylation T3844 0.389 _T(ph)SLVIVESADNQPETCER_
ANK2 Phosphorylation S3845 0.659 0.389 _KTS(ph)LVIVESADNQPETCER_
ARPP19 Phosphorylation S23 -0.329 0.094 _VTS(ph)PEKAEEAK_
ARPP19 Phosphorylation S83 -0.198 0.181 _YFDS(ph)GDYNMAK_
ARPP19 Ubiquitylation K90 0.740 0.543 _YFDSGDYNMAK(gl)AK_
ARPP19 Phosphorylation S104 0.052 -0.643 _KPS(ph)LVASK_
DLG1 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG1 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG1 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG1 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG1 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG1 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG1 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG1 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG1 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
NEDD4L Ubiquitylation K149 -0.001 0.036 _LK(gl)MAYMPK_
NEDD4L Phosphorylation T302 0.166 0.120 _T(ph)SPQELSEELSR_
NEDD4L Phosphorylation S303 0.166 0.120 _T(ph)SPQELSEELSR_
NEDD4L Phosphorylation S448 0.067 -0.137 _SLS(ph)SPTVTLSAPLEGAK_
NEDD4L Phosphorylation S449 -0.460 -0.435 _SLSS(ph)PTVTLSAPLEGAK_
NEDD4L Ubiquitylation K462 -0.635 -0.011 _SLSSPTVTLSAPLEGAK(gl)DSPVRR_
NEDD4L Ubiquitylation K471 -0.787 _AVK(gl)DTLSNPQSPQPSPYNSPKPQHK_
NEDD4L Ubiquitylation K531 0.704 _LK(gl)FPVHMR_
NEDD4L Ubiquitylation K539 -1.106 -1.175 _SK(gl)TSLNPNDLGPLPPGWEER_
NEDD4L Ubiquitylation K639 0.649 0.864 _IMSVK(gl)RPDVLK_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
YWHAE Ubiquitylation K38 0.710 1.822 _YDEMVESMK(gl)K_
YWHAE Ubiquitylation K39 1.734 _YDEMVESMKK(gl)_
YWHAE Ubiquitylation K60 0.554 1.732 _NLLSVAYK(gl)NVIGAR_
YWHAE Ubiquitylation K83 0.375 0.643 _IISSIEQKEENK(gl)GGEDKLK_
YWHAE Ubiquitylation K90 1.103 _GGEDKLK(gl)MIR_
YWHAE Ubiquitylation K116 -0.289 _LICCDILDVLDK(gl)HLIPAANTGESK_
YWHAE Ubiquitylation K133 0.653 1.264 _VFYYK(gl)M(ox)K_
YWHAE Ubiquitylation K152 0.031 0.601 _K(gl)EAAENSLVAYK_
YWHAE Phosphorylation S210 0.534 0.506 _AAFDDAIAELDTLS(ph)EESYK_
YWHAE Phosphorylation S213 0.541 _AAFDDAIAELDTLSEES(ph)YK_


© Copyright Svejstrup Laboratory 2015