bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
positive regulation of G2/M transition of mitotic cell cycle
(GO:0010971)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
BRD4 2 -0.320 0.280 0.080 0.220 0.614 0.191 0.117
PBX2 2 -0.170 0.670 -0.186 -0.124
MTA3 0 -0.430 1.040
MTA3 0 -0.430 1.040 0.282 0.258 0.926 0.072 0.430
APP 0 0.100 -0.260 0.285
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410
PBX1 0 -0.600 0.280
PBX1 0 -0.600 0.280 -0.186 -0.124

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
APP Ubiquitylation K751 -1.778 -1.280 _HLSK(gl)M(ox)QQNGYENPTYK_
BRD4 Phosphorylation S469 -0.308 -1.544 _MPDEPEEPVVAVS(ph)SPAVPPPTK_
BRD4 Phosphorylation S470 -0.308 -0.758 _MPDEPEEPVVAVSS(ph)PAVPPPTK_
BRD4 Phosphorylation S1083 -1.699 -1.783 _EAPSPLMIHSPQMSQFQSLTHQS(ph)PPQQNVQPK_
BRD4 Phosphorylation S1117 2.833 1.857 _IHS(ph)PIIR_
BRD4 Phosphorylation S1126 1.336 0.890 _SEPFS(ph)PSLRPEPPKHPESIK_
MTA3 Ubiquitylation K32 -0.505 _RIEELNK(gl)TASGNVEAK_
MTA3 Phosphorylation S428 0.030 _MPTQSEEEKLS(ph)PSPTTEDPR_
MTA3 Ubiquitylation K509 -0.005 -0.041 _AECK(gl)MLLNS_
MTA3 Phosphorylation S519 0.339 -0.158 _HAELSGS(ph)PLK_
PBX1 Ubiquitylation K164 -0.541 _SK(gl)LAQIR_
PBX1 Ubiquitylation K195 -1.614 _TRPISPK(gl)EIER_
PBX2 Ubiquitylation K164 -0.541 _SK(gl)LAQIR_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_


© Copyright Svejstrup Laboratory 2015