bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
positive regulation of cell-matrix adhesion
(GO:0001954)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
GSK3B 2 1.020 -0.870 -1.128 1.091
ILK 1 -1.560 3.680 -0.463 -0.527
DMD 1 0.960 -0.560 0.854 0.214
PRKCZ 0 -0.290 0.310
CDK6 0 -0.190 0.160
CDK6 0 -0.190 0.160 -0.510 0.013
EPB41L5 0 -0.210 0.040
UTRN 0 0.740 -0.670 -0.497 0.668 0.380

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CDK6 Ubiquitylation K3 0.121 0.039 _(ac)MEK(gl)DGLCR_
CDK6 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK6 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK6 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK6 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK6 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK6 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK6 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK6 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK6 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK6 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK6 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK6 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
DMD Ubiquitylation K3317 -0.200 -0.978 _CNICK(gl)ECPIIGFR_
DMD Phosphorylation S3623 2.940 0.225 _SDS(ph)SQPMLLR_
EPB41L5 Ubiquitylation K223 -0.178 _GQTPAQAETNYLNK(gl)AK_
EPB41L5 Ubiquitylation K225 -0.178 _GQTPAQAETNYLNK(gl)AK_
EPB41L5 Ubiquitylation K350 1.203 _YSGK(gl)TEYQTTK_
EPB41L5 Ubiquitylation K510 0.383 -0.287 _LK(gl)QLEMENSPLLSPR_
GSK3B Phosphorylation S9 -0.483 0.010 _TTS(ph)FAESCKPVQQPSAFGSMK_
GSK3B Ubiquitylation K85 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Ubiquitylation K86 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Phosphorylation S215 0.296 0.477 _GEPNVS(ph)YICSR_
GSK3B Phosphorylation Y216 0.356 0.376 _GEPNVSY(ph)ICSR_
GSK3B Phosphorylation T390 2.800 2.527 _IQAAAST(ph)PTNATAASDANTGDR_
ILK Ubiquitylation K85 -0.777 _DIVQK(gl)LLQYK_
ILK Ubiquitylation K426 -0.300 _LMK(gl)ICMNEDPAK_
ILK Ubiquitylation K435 -2.732 _ICMNEDPAK(gl)RPK_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
UTRN Ubiquitylation K2645 -0.147 _NLQSK(gl)TELTPEER_
UTRN Ubiquitylation K2793 0.536 _LK(gl)QLQEAHR_
UTRN Ubiquitylation K3065 0.998 0.577 _VAAAETAK(gl)HQAK_
UTRN Ubiquitylation K3074 0.216 _CNICK(gl)ECPIVGFR_
UTRN Phosphorylation S3297 -0.222 _GLPVGS(ph)PPESIISPHHTSEDSELIAEAK_


© Copyright Svejstrup Laboratory 2015