bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: CNOT4

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
CNOT4 0 -1.301 0.000 -0.080

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
CNOT4 Phosphorylation S4 -0.674 -0.627 _S(ph)PDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICR_
CNOT4 Phosphorylation S2 -0.674 -1.015 _(ac)S(ph)RSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICR_

Background Information for CNOT4:


Pubmed-CNOT4 »
Uniprot-CNOT4 »
Biogrid-CNOT4 »
ProteomicsDB-CNOT4 »

Tumorportal-CNOT4 »
COSMIC-CNOT4 »
GenomeRNAi-CNOT4 »
Genecards-CNOT4


Protein-protein Interactions for CNOT4
Show screen data for Category Name and Description Link to cat description Data Source


Protein Domains in CNOT4
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members RRM_dom IPR000504 4.34
Category members RRM_dom_euk IPR003954 0.18
Category members Znf_RING IPR001841 0


Protein complexes (CORUM database) featuring CNOT4
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring CNOT4
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Pathway Pathway_771 REACTOME_METABOLISM_OF_RNA 0 INF
Category members Pathway Pathway_773 REACTOME_METABOLISM_OF_MRNA 0 INF
Category members GO Category GO:0003723 RNA binding Database INF
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005829 cytosol Database INF
Category members GO Category GO:0010467 gene expression Database INF
Category members GO Category GO:0016070 RNA metabolic process Database INF
Category members GO Category GO:0016071 mRNA metabolic process Database INF
Category members GO Category GO:0000166 nucleotide binding Database 5.91
Category members GO Category GO:0003676 nucleic acid binding Database 0.83
Category members GO Category GO:0008270 zinc ion binding Database 0.29
Category members Pathway Pathway_310 KEGG_RNA_DEGRADATION 0 0.26
Category members GO Category GO:0004842 ubiquitin-protein ligase activity Database 0.24
Category members GO Category GO:0051865 protein autoubiquitination Database 0.18
Category members GO Category GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Database 0.17
Category members Pathway Pathway_842 REACTOME_DEADENYLATION_DEPENDENT_MRNA_DECAY 0 0.1
Category members GO Category GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Database 0.06
Category members Pathway Pathway_841 REACTOME_DEADENYLATION_OF_MRNA 0 0
Category members GO Category GO:0030014 CCR4-NOT complex Database 0


.

© Copyright Svejstrup Laboratory 2015