bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
REACTOME_INTEGRIN_ALPHAIIB_BETA3_SIGNALING
(Pathway_931)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
TLN1 1 -0.130 0.000 0.807 0.246 0.137
CSK 0 1.200 -0.960 -1.211
CSK 0 1.200 -0.960
SOS1 0 0.500 -0.620 -0.570
RAP1B 0 -0.520 0.540 -0.200 0.374 0.556
PDPK1 0 0.050 -0.440
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
CRK 0 -0.790 0.230
FGA 0 -5.029
FGB 0 0.920 -1.250 -4.320
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
PTPN1 0 -0.150 0.310 1.066 0.459 0.251 0.322 0.379
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
CRK Phosphorylation S40 0.533 0.363 _DS(ph)STSPGDYVLSVSENSR_
CRK Phosphorylation S41 1.065 0.801 _DSS(ph)TSPGDYVLSVSENSR_
CSK Ubiquitylation K196 -0.133 _SGWALNMKELK(gl)_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
PDPK1 Phosphorylation S241 0.358 0.361 _ANS(ph)FVGTAQYVSPELLTEK_
PDPK1 Ubiquitylation K257 0.571 -0.234 _ANSFVGTAQYVSPELLTEK(gl)SACK_
PTPN1 Phosphorylation S352 0.032 _GS(ph)PLNAAPYGIESMSQDTEVR_
PTPN1 Phosphorylation S365 -0.247 0.956 _GSPLNAAPYGIESMS(ph)QDTEVR_
PTPN1 Phosphorylation S378 1.462 1.262 _VVGGS(ph)LR_
RAP1B Ubiquitylation K174 0.197 _KTPVPGK(gl)AR_
SOS1 Phosphorylation S1082 0.278 _IPESETESTASAPNS(ph)PR_
SOS1 Phosphorylation S1166 0.097 -0.094 _RPESAPAES(ph)SPSK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
TLN1 Ubiquitylation K334 -0.489 0.561 _LLGITK(gl)ECVM(ox)R_
TLN1 Phosphorylation S423 0.105 _DHFGLEGDEESTMLEDS(ph)VSPKK_
TLN1 Phosphorylation S425 -0.366 -0.322 _DHFGLEGDEESTMLEDSVS(ph)PKK_
TLN1 Ubiquitylation K869 -0.260 _ILADATAK(gl)MVEAAK_
TLN1 Ubiquitylation K1541 0.365 2.311 _EVANSTANLVK(gl)TIK_
TLN1 Ubiquitylation K2021 0.309 0.479 _EGILK(gl)TAK_


© Copyright Svejstrup Laboratory 2015