bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
membrane depolarization
(GO:0051899)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
JUN 3 -0.930 0.930 -0.126
PRKCZ 0 -0.290 0.310
CAV1 0 1.150 -0.150
CAV1 0 1.150 -0.150
CAV1 0 1.150 -0.150
PARK7 0 -0.660 0.930

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CAV1 Ubiquitylation K5 0.591 0.963 _(ac)SGGK(gl)YVDSEGHLYTVPIR_
CAV1 Phosphorylation S6 0.836 0.688 _(ac)ADELS(ph)EKQVYDAHTK_
CAV1 Ubiquitylation K8 0.244 0.734 _(ac)ADELSEK(gl)QVYDAHTK_
CAV1 Ubiquitylation K26 0.724 0.894 _EQGNIYK(gl)PNNK_
CAV1 Ubiquitylation K30 -0.008 0.317 _EQGNIYKPNNK(gl)AMADELSEK_
CAV1 Ubiquitylation K39 0.690 1.170 _AMADELSEK(gl)QVYDAHTK_
CAV1 Phosphorylation S76 0.607 0.527 _AMADELS(ph)EK_
CAV1 Ubiquitylation K176 -0.259 _INLQK(gl)EI_
JUN Phosphorylation S58 -0.167 -1.247 _AKNS(ph)DLLTSPDVGLLK_
JUN Phosphorylation T62 2.545 1.674 _NSDLLT(ph)SPDVGLLK_
JUN Phosphorylation S63 2.030 1.458 _NSDLLTS(ph)PDVGLLK_
JUN Ubiquitylation K70 9.213 _NSDLLTSPDVGLLK(gl)_
JUN Phosphorylation S73 1.499 0.845 _LAS(ph)PELER_
JUN Phosphorylation S243 -0.642 -1.399 _LQALKEEPQTVPEMPGETPPLS(ph)PIDMESQER_
JUN Ubiquitylation K309 1.034 0.155 _EQVAQLK(gl)QK_
PARK7 Ubiquitylation K41 0.222 0.590 _VTVAGLAGK(gl)DPVQCSR_
PARK7 Ubiquitylation K93 -0.291 _EILK(gl)EQENR_
PARK7 Ubiquitylation K132 0.639 _VTTHPLAKDK(gl)_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_


© Copyright Svejstrup Laboratory 2015