bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
progesterone receptor signaling pathway
(GO:0050847)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
UBR5 1 0.470 -0.820 -0.310
UBR5 1 0.470 -0.820 -1.380
UBR5 1 0.470 -0.820 0.046 0.305 0.536 -0.482
NEDD4 0 -1.320 1.730
PHB 0 -1.260 1.640 -0.429 0.649 -1.697
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
NEDD4 Phosphorylation Y751 -0.924 _RGSLQAY(ph)TFEEQPTLPVLLPTSSGLPPGWEEK_
NEDD4 Ubiquitylation K874 0.127 _LK(gl)IPAHLR_
NEDD4 Ubiquitylation K882 -0.919 0.114 _GK(gl)TSLDTSNDLGPLPPGWEER_
PHB Ubiquitylation K83 -0.521 _NVPVITGSK(gl)DLQNVNITLR_
PHB Ubiquitylation K186 -0.124 _EFTEAVEAK(gl)QVAQQEAER_
PHB Ubiquitylation K202 0.125 _FVVEK(gl)AEQQKK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
UBR5 Phosphorylation S327 0.474 0.437 _WLDGAS(ph)FDNER_
UBR5 Ubiquitylation K337 -0.172 0.548 _GSTSK(gl)EGEPNLDKK_
UBR5 Ubiquitylation K346 -0.580 _EGEPNLDKK(gl)_
UBR5 Ubiquitylation K423 -1.074 _ATFLGLTNEK(gl)_
UBR5 Ubiquitylation K583 -0.122 _SPESLK(gl)NMEK_
UBR5 Ubiquitylation K587 -0.122 _SPESLK(gl)NMEK_
UBR5 Ubiquitylation K672 -0.561 -0.090 _VLK(gl)VDGAYVAVK_
UBR5 Ubiquitylation K1109 0.878 0.766 _ELLSAK(gl)DAR_
UBR5 Ubiquitylation K1248 0.892 _TLIAGQK(gl)SAR_
UBR5 Ubiquitylation K1351 0.012 0.779 _SMIMFGSQENK(gl)DPLSASSR_
UBR5 Phosphorylation S1549 1.569 0.771 _RIS(ph)QSQPVR_
UBR5 Phosphorylation S2026 -1.786 -1.571 _RS(ph)DSM(ox)TFLGCIPPNPFEVPLAEAIPLADQPHLLQPNAR_


© Copyright Svejstrup Laboratory 2015