bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
bone resorption
(GO:0045453)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
NCDN 1 -0.440 0.530 3.332 -0.684 -0.548
RAB7A 1 1.540 -0.590 0.299 1.971 -0.775 0.288 -0.293
RAC2 1 -1.520 2.710 0.486 -0.364 -0.568
RAC1 0 -0.580 1.580 0.486 -0.364 -0.568
TPP1 0 -0.540 0.760 0.431 1.429 1.399
CTNNB1 0 0.490 -0.230
CTNNB1 0 0.490 -0.230 -0.415 0.628 0.215
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CTNNB1 Ubiquitylation K158 -1.265 _AIPELTK(gl)LLNDEDQVVVNK_
CTNNB1 Ubiquitylation K180 -0.546 -0.636 _AAVM(ox)VHQLSK(gl)K_
CTNNB1 Ubiquitylation K181 -0.717 -0.729 _AAVMVHQLSKK(gl)_
CTNNB1 Phosphorylation S191 -0.024 0.129 _S(ph)PQMVSAIVR_
CTNNB1 Ubiquitylation K435 -0.350 _NK(gl)MM(ox)VCQVGGIEALVR_
CTNNB1 Ubiquitylation K496 -1.262 _LHYGLPVVVK(gl)_
CTNNB1 Phosphorylation S552 1.233 1.224 _RTS(ph)MGGTQQQFVEGVR_
CTNNB1 Phosphorylation T556 1.275 0.995 _RTSM(ox)GGT(ph)QQQFVEGVR_
CTNNB1 Ubiquitylation K671 -0.941 -0.934 _MSEDKPQDYK(gl)K_
NCDN Ubiquitylation K283 -0.145 _NPALK(gl)LAAR_
RAB7A Ubiquitylation K32 0.922 1.260 _K(gl)FSNQYK_
RAB7A Ubiquitylation K38 0.713 1.294 _FSNQYK(gl)ATIGADFLTK_
RAB7A Ubiquitylation K146 -0.718 _AQAWCYSK(gl)NNIPYFETSAK_
RAC1 Ubiquitylation K115 -1.745 -0.215 _AK(gl)WYPEVR_
RAC1 Ubiquitylation K142 0.492 _LDLRDDK(gl)DTIEK_
RAC1 Ubiquitylation K152 0.099 -0.292 _K(gl)LTPITYPQGLAMAK_
RAC1 Ubiquitylation K166 -0.981 -0.655 _LTPITYPQGLAMAK(gl)EIGAVK_
RAC1 Ubiquitylation K172 1.026 0.412 _EIGAVK(gl)YLECSALTQR_
RAC1 Ubiquitylation K185 -0.113 0.578 _GLK(gl)TVFDEAIR_
RAC1 Ubiquitylation K202 -1.379 -1.447 _AVLCPPPVK(gl)KR_
RAC1 Ubiquitylation K203 -1.708 -1.447 _AVLCPPPVKK(gl)_
RAC2 Ubiquitylation K115 -1.745 -0.215 _AK(gl)WYPEVR_
RAC2 Ubiquitylation K142 0.492 _LDLRDDK(gl)DTIEK_
RAC2 Ubiquitylation K152 0.099 -0.292 _K(gl)LTPITYPQGLAMAK_
RAC2 Ubiquitylation K166 -0.981 -0.655 _LTPITYPQGLAMAK(gl)EIGAVK_
RAC2 Ubiquitylation K172 1.026 0.412 _EIGAVK(gl)YLECSALTQR_
RAC2 Ubiquitylation K185 -0.113 0.578 _GLK(gl)TVFDEAIR_
RAC2 Ubiquitylation K202 -1.379 -1.447 _AVLCPPPVK(gl)KR_
RAC2 Ubiquitylation K203 -1.708 -1.447 _AVLCPPPVKK(gl)_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_


© Copyright Svejstrup Laboratory 2015