bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
establishment or maintenance of epithelial cell apical/basal polarity
(GO:0045197)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
MARK2 2 0.390 -0.570 -0.342 -0.924
DLG3 2 0.180 -1.120 1.552 0.102 0.488
DLG3 2 0.180 -1.120
ILK 1 -1.560 3.680 -0.463 -0.527
ERBB2IP 0 0.430 0.290 -0.247 -0.786 -0.105
VANGL2 0 -1.030 1.450
PRKCI 0 0.730 -0.460 1.483 0.192 0.350

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
DLG3 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG3 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG3 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG3 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG3 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG3 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG3 Ubiquitylation K368 1.043 1.755 _IIEGGAAQK(gl)DGR_
DLG3 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG3 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG3 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG3 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG3 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
ERBB2IP Phosphorylation S1133 -0.960 _TYS(ph)IDGPNASRPQSARPSINEIPER_
ILK Ubiquitylation K85 -0.777 _DIVQK(gl)LLQYK_
ILK Ubiquitylation K426 -0.300 _LMK(gl)ICMNEDPAK_
ILK Ubiquitylation K435 -2.732 _ICMNEDPAK(gl)RPK_
MARK2 Phosphorylation S387 3.794 _PSADLTNSS(ph)APSPSHK_
MARK2 Phosphorylation S390 5.149 4.932 _PSADLTNSSAPS(ph)PSHK_
MARK2 Phosphorylation S456 -1.253 -1.182 _VPAS(ph)PLPGLER_
MARK2 Phosphorylation S486 -0.028 0.163 _SRNS(ph)PLLER_
MARK2 Phosphorylation S569 -0.860 -0.742 _VPVAS(ph)PSAHNISSSGGAPDR_
MARK2 Phosphorylation S571 -0.724 _VPVASPS(ph)AHNISSSGGAPDR_
PRKCI Ubiquitylation K244 0.289 _ESGK(gl)ASSSLGLQDFDLLR_
PRKCI Ubiquitylation K488 -0.090 0.847 _SLSVK(gl)AASVLK_
VANGL2 Ubiquitylation K379 0.582 _LQEEEQK(gl)NPR_


.

© Copyright Svejstrup Laboratory 2015