bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
regulation of transcription from RNA polymerase II promoter in response to oxidative stress
(GO:0043619)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
HMOX1 0 0.330 0.220 -1.817 -1.289
HIF1A 0 -0.480 0.400
ARNT 0 1.120 -0.500
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ARNT Phosphorylation S81 1.133 _FARS(ph)DDEQSSADKER_
ARNT Ubiquitylation K421 -2.502 _DSFQQVVK(gl)LK_
HIF1A Ubiquitylation K10 -1.686 _(ac)MEGAGGANDK(gl)K_
HIF1A Ubiquitylation K11 -1.686 _(ac)MEGAGGANDK(gl)K_
HIF1A Ubiquitylation K173 -0.662 _MK(gl)CTLTSR_
HIF1A Ubiquitylation K186 -0.590 _TMNIK(gl)SATWK_
HIF1A Ubiquitylation K252 -0.784 _HSLDM(ox)K(gl)FSYCDER_
HIF1A Ubiquitylation K371 -0.508 _PVESSDMK(gl)MTQLFTK_
HIF1A Ubiquitylation K378 -0.077 _MTQLFTK(gl)VESEDTSSLFDK_
HIF1A Ubiquitylation K390 -0.348 _VESEDTSSLFDK(gl)LKK_
HIF1A Ubiquitylation K392 -0.546 _VESEDTSSLFDKLK(gl)_
HIF1A Ubiquitylation K393 -0.451 _VESEDTSSLFDKLKK(gl)_
HIF1A Ubiquitylation K710 -1.696 _TTVPEEELNPK(gl)ILALQNAQR_
HMOX1 Ubiquitylation K243 -0.972 _ASNK(gl)VQDSAPVETPR_
HMOX1 Ubiquitylation K256 -1.769 _GK(gl)PPLNTR_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_


© Copyright Svejstrup Laboratory 2015