bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
endothelial cell proliferation
(GO:0001935)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
DLG1 1 0.400 -0.220 1.552 0.102 0.488
SCARB1 0 0.990 -0.330
SCARB1 0 0.990 -0.330 -0.012 -0.480
HMOX1 0 0.330 0.220 -1.817 -1.289
APOA1 0 0.850 -0.420 -3.959

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
DLG1 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG1 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG1 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG1 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG1 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG1 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG1 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG1 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG1 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
HMOX1 Ubiquitylation K243 -0.972 _ASNK(gl)VQDSAPVETPR_
HMOX1 Ubiquitylation K256 -1.769 _GK(gl)PPLNTR_
SCARB1 Ubiquitylation K480 0.325 0.520 _GSVLQEAK(gl)L_


© Copyright Svejstrup Laboratory 2015