bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
ACUTE PROMYELOCYTIC LEUKEMIA
(ACUTE_PROMYELOCYTIC_LEUKEMIA)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
NUMA1 4 -0.500 0.260
NUMA1 4 -0.500 0.260 1.086 -0.115 0.036 0.805 0.500
NUMA1 4 -0.500 0.260 0.682 0.665 0.281
NABP1 2 2.632 2.887
PML 1 -0.420 0.350 -0.244 0.322
NPM1 1 1.010 -0.750 0.063 -0.066 -0.259
STAT5B 0 0.670 -0.960

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
NABP1 Ubiquitylation K8 -1.168 _(ac)TTETFVK(gl)DIKPGLK_
NPM1 Phosphorylation S4 -0.102 0.205 _(ac)MEDS(ph)MDMDMSPLRPQNYLFGCELK_
NPM1 Phosphorylation S10 0.493 0.606 _(ac)MEDSMDM(ox)DM(ox)S(ph)PLRPQNYLFGCELK_
NPM1 Phosphorylation Y67 0.604 0.383 _TVSLGAGAKDELHIVEAEAMNY(ph)EGSPIKVTLATLK_
NPM1 Phosphorylation S70 0.285 0.333 _TVSLGAGAKDELHIVEAEAMNYEGS(ph)PIK_
NPM1 Phosphorylation T75 0.611 0.229 _DELHIVEAEAMNYEGSPIKVT(ph)LATLK_
NPM1 Phosphorylation T78 0.397 _TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLAT(ph)LK_
NPM1 Phosphorylation S125 0.202 0.017 _CGSGPVHISGQHLVAVEEDAES(ph)EDEEEEDVK_
NPM1 Phosphorylation S139 -0.611 _LLSIS(ph)GKR_
NPM1 Ubiquitylation K141 0.568 1.699 _LLSISGK(gl)R_
NPM1 Ubiquitylation K150 -1.308 0.669 _SAPGGGSK(gl)VPQKK_
NPM1 Ubiquitylation K202 0.335 0.204 _SIRDTPAK(gl)NAQK_
NPM1 Phosphorylation S227 0.788 _SKGQES(ph)FKK_
NPM1 Phosphorylation S243 -0.070 0.063 _GPSS(ph)VEDIK_
NPM1 Ubiquitylation K248 0.294 1.847 _GPSSVEDIK(gl)AK_
NPM1 Ubiquitylation K250 0.931 1.267 _AK(gl)MQASIEK_
NPM1 Phosphorylation S254 -0.677 0.371 _MQAS(ph)IEK_
NPM1 Ubiquitylation K257 0.236 0.753 _MQASIEK(gl)GGSLPK_
NPM1 Phosphorylation S260 -0.202 0.203 _GGS(ph)LPKVEAK_
NPM1 Ubiquitylation K267 0.954 1.794 _VEAK(gl)FINYVK_
NUMA1 Phosphorylation S82 2.155 _KHPS(ph)SPECLVSAQK_
NUMA1 Phosphorylation S175 -0.787 -0.756 _APVPSTCSSTFPEELS(ph)PPSHQAK_
NUMA1 Phosphorylation S401 2.552 2.428 _LSQLEEHLS(ph)QLQDNPPQEK_
NUMA1 Ubiquitylation K567 1.115 _HQVEQLSSSLK(gl)QK_
NUMA1 Ubiquitylation K569 1.115 _HQVEQLSSSLK(gl)QK_
NUMA1 Phosphorylation S706 2.397 _ALMTIIPDLS(ph)PNNPLSK_
NUMA1 Ubiquitylation K897 0.451 1.826 _ALQQVQEK(gl)EVR_
NUMA1 Ubiquitylation K903 0.485 _AQK(gl)LADDLSTLQEK_
NUMA1 Ubiquitylation K914 -0.138 0.483 _LADDLSTLQEK(gl)MAATSK_
NUMA1 Ubiquitylation K920 -0.270 _MAATSK(gl)EVAR_
NUMA1 Ubiquitylation K945 -0.207 _ELVK(gl)EPAR_
NUMA1 Ubiquitylation K1144 -0.145 _LEQQCQK(gl)QQEQADSLER_
NUMA1 Phosphorylation S1231 0.725 1.160 _KNS(ph)LISSLEEEVSILNR_
NUMA1 Ubiquitylation K1336 0.352 _AEELGQELK(gl)AWQEK_
NUMA1 Ubiquitylation K1481 0.696 _EK(gl)YVQELAAVR_
NUMA1 Ubiquitylation K1517 0.737 0.662 _ELEVMTAK(gl)YEGAK_
NUMA1 Ubiquitylation K1579 0.874 _LK(gl)AVQAQGGESQQEAQR_
NUMA1 Ubiquitylation K1671 1.528 _LGHELQQAGLK(gl)TK_
NUMA1 Ubiquitylation K1705 0.380 _DLGK(gl)FQVATDALK_
NUMA1 Ubiquitylation K1714 1.086 _FQVATDALK(gl)SR_
NUMA1 Phosphorylation T1755 -0.222 _TQPDGT(ph)SVPGEPASPISQR_
NUMA1 Phosphorylation S1756 0.224 _TQPDGTS(ph)VPGEPASPISQR_
NUMA1 Phosphorylation S1763 0.155 -0.387 _TQPDGTSVPGEPAS(ph)PISQR_
NUMA1 Phosphorylation S1766 -0.247 _TQPDGTSVPGEPASPIS(ph)QR_
NUMA1 Phosphorylation S1775 -0.770 0.419 _VES(ph)LESLYFTPIPAR_
NUMA1 Phosphorylation S1794 0.156 0.929 _SQAPLES(ph)SLDSLGDVFLDSGRK_
NUMA1 Phosphorylation S1795 -0.386 1.025 _SQAPLESS(ph)LDSLGDVFLDSGR_
NUMA1 Ubiquitylation K1828 0.570 _TTQIINITMTKK(gl)_
NUMA1 Phosphorylation S1868 -0.414 -0.685 _LGS(ph)PDYGNSALLSLPGYRPTTR_
NUMA1 Phosphorylation T2006 -0.114 -1.359 _RVSLEPHQGPGT(ph)PESK_
PML Ubiquitylation K394 0.515 0.360 _LQDLSSCITQGK(gl)DAAVSKK_
PML Phosphorylation S403 3.141 _KAS(ph)PEAASTPRDPIDVDLPEEAER_
PML Ubiquitylation K476 -0.403 -0.735 _GPSYGEDVSNTTTAQK(gl)R_
PML Phosphorylation S504 -0.198 -0.109 _S(ph)SPEQPRPSTSK_
PML Phosphorylation S505 -0.198 -0.109 _S(ph)SPEQPRPSTSK_
PML Phosphorylation S518 -1.632 -1.605 _AVS(ph)PPHLDGPPS(ph)PR_
PML Phosphorylation S527 -1.392 -1.605 _AVS(ph)PPHLDGPPS(ph)PR_
PML Phosphorylation S530 0.466 0.093 _S(ph)PVIGSEVFLPNSNHVASGAGEAEER_
PML Ubiquitylation K623 -0.784 _IDNETQK(gl)ISQLAAVNR_
STAT5B Phosphorylation S194 0.270 _IQAQFGPLAQLS(ph)PQER_


© Copyright Svejstrup Laboratory 2015