bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
TNF-alpha/NF-kappa B signaling complex (SEC16A, CHUK, IKBKB, NFKB2, REL, IKBKG, MAP3K14, RELA, FBXW7, USP2)
(5194)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SEC16A 1 0.930 -0.450 0.465 -0.688
IKBKG 0
NFKB2 0 1.750 -0.820
IKBKB 0 0.400 0.610
RELA 0 -1.130 1.600 0.793
CHUK 0 -0.480

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CHUK Ubiquitylation K296 -1.637 _GGPVDLTLK(gl)QPR_
IKBKB Ubiquitylation K106 0.253 _K(gl)YLNQFENCCGLR_
IKBKB Phosphorylation S672 0.670 0.244 _GPVSGS(ph)PDSMNASR_
IKBKG Ubiquitylation K285 -1.202 -0.389 _QEVIDKLK(gl)EEAEQHK_
IKBKG Ubiquitylation K309 0.123 0.725 _AQADIYK(gl)ADFQAER_
IKBKG Ubiquitylation K344 0.060 _LK(gl)ASCQESAR_
IKBKG Phosphorylation S387 -1.270 -1.418 _S(ph)PPEEPPDFCCPK_
NFKB2 Ubiquitylation K741 -2.393 _GHTPLDLTCSTK(gl)VK_
NFKB2 Ubiquitylation K743 -0.624 _GHTPLDLTCSTKVK(gl)_
SEC16A Phosphorylation S73 -0.792 _S(ph)SPPVLQGPAPAGFSQHPGLLVPHTHAR_
SEC16A Phosphorylation S74 -0.792 _S(ph)SPPVLQGPAPAGFSQHPGLLVPHTHAR_
SEC16A Phosphorylation S122 1.124 _AHAS(ph)PFSGALTPSAPPGPEMNR_
SEC16A Phosphorylation S568 0.516 0.641 _QIDS(ph)SPVGGETDETTVSQNYR_
SEC16A Phosphorylation S569 0.516 0.566 _QIDSS(ph)PVGGETDETTVSQNYR_
SEC16A Phosphorylation S957 -0.494 -0.870 _AGSALPGFANS(ph)PAGSTSVVLVPPAHGTLVPDGNK_
SEC16A Phosphorylation S1069 -0.875 -1.477 _AQQELVPPQQQAS(ph)PPQLPK_
SEC16A Ubiquitylation K1313 -0.030 _EHSAFGDRPEK(gl)R_
SEC16A Phosphorylation T1325 -0.701 -0.174 _FT(ph)GSFDDDPDPHRDPYGEEVDRR_
SEC16A Phosphorylation S1327 -0.966 -0.298 _FTGS(ph)FDDDPDPHRDPYGEEVDRR_
SEC16A Phosphorylation S1398 -0.421 _SHNVAAGSYEAPLPPGS(ph)FHGDFAYGTYR_
SEC16A Phosphorylation T1440 -1.033 _SNFSSGPGFPEYGYPADTVWPAMEQVSSRPT(ph)SPEK_
SEC16A Phosphorylation S1441 -0.463 -1.382 _SNFSSGPGFPEYGYPADTVWPAMEQVSSRPTS(ph)PEK_
SEC16A Phosphorylation S1964 -1.818 -1.442 _LLPSAPQTLPDGPLAS(ph)PAR_
SEC16A Phosphorylation S2022 -1.272 _S(ph)PDPGIVPQEAPVGNSLSELSEENFDGK_
SEC16A Phosphorylation T2054 -0.035 0.271 _FANLT(ph)PSR_
SEC16A Phosphorylation S2083 -0.428 _ADSGPTQPPLSLS(ph)PAPETK_
SEC16A Phosphorylation S2252 1.901 1.257 _NDGLLALS(ph)SPDAEEPQLPDGTGR_
SEC16A Phosphorylation S2253 2.097 1.217 _NDGLLALSS(ph)PDAEEPQLPDGTGR_


.

© Copyright Svejstrup Laboratory 2015