bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: SEC16A

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
SEC16A 1 3.101 0.930 -0.450 0.465 -0.688

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
SEC16A Phosphorylation S2252 1.901 1.257 _NDGLLALS(ph)SPDAEEPQLPDGTGR_
SEC16A Phosphorylation S2253 2.097 1.217 _NDGLLALSS(ph)PDAEEPQLPDGTGR_
SEC16A Phosphorylation S122 1.124 _AHAS(ph)PFSGALTPSAPPGPEMNR_
SEC16A Phosphorylation S568 0.516 0.641 _QIDS(ph)SPVGGETDETTVSQNYR_
SEC16A Phosphorylation S569 0.516 0.566 _QIDSS(ph)PVGGETDETTVSQNYR_
SEC16A Phosphorylation T2054 -0.035 0.271 _FANLT(ph)PSR_
SEC16A Phosphorylation T1325 -0.701 -0.174 _FT(ph)GSFDDDPDPHRDPYGEEVDRR_
SEC16A Phosphorylation S1327 -0.966 -0.298 _FTGS(ph)FDDDPDPHRDPYGEEVDRR_
SEC16A Phosphorylation S1398 -0.421 _SHNVAAGSYEAPLPPGS(ph)FHGDFAYGTYR_
SEC16A Phosphorylation S73 -0.792 _S(ph)SPPVLQGPAPAGFSQHPGLLVPHTHAR_
SEC16A Phosphorylation S74 -0.792 _S(ph)SPPVLQGPAPAGFSQHPGLLVPHTHAR_
SEC16A Phosphorylation S957 -0.494 -0.870 _AGSALPGFANS(ph)PAGSTSVVLVPPAHGTLVPDGNK_
SEC16A Phosphorylation S2022 -1.272 _S(ph)PDPGIVPQEAPVGNSLSELSEENFDGK_
SEC16A Phosphorylation S1441 -0.463 -1.382 _SNFSSGPGFPEYGYPADTVWPAMEQVSSRPTS(ph)PEK_
SEC16A Phosphorylation S1964 -1.818 -1.442 _LLPSAPQTLPDGPLAS(ph)PAR_
SEC16A Phosphorylation S1069 -0.875 -1.477 _AQQELVPPQQQAS(ph)PPQLPK_
SEC16A Ubiquitylation K1313 -0.030 _EHSAFGDRPEK(gl)R_
SEC16A Phosphorylation T1440 -1.033 _SNFSSGPGFPEYGYPADTVWPAMEQVSSRPT(ph)SPEK_
SEC16A Phosphorylation S2083 -0.428 _ADSGPTQPPLSLS(ph)PAPETK_

Background Information for SEC16A:


Pubmed-SEC16A »
Uniprot-SEC16A »
Biogrid-SEC16A »
ProteomicsDB-SEC16A »

Tumorportal-SEC16A »
COSMIC-SEC16A »
GenomeRNAi-SEC16A »
Genecards-SEC16A


Protein-protein Interactions for SEC16A
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait ACTB Cat. description Hein, Mann, Cell 2015
Category members IP bait AKAP8 Cat. description Hein, Mann, Cell 2015
Category members IP bait ARX Cat. description Hein, Mann, Cell 2015
Category members IP bait CALML3 Cat. description Hein, Mann, Cell 2015
Category members IP bait CAPZA2 Cat. description Hein, Mann, Cell 2015
Category members IP bait CDK2 Cat. description Hein, Mann, Cell 2015
Category members IP bait CDK5RAP2 Cat. description Hein, Mann, Cell 2015
Category members IP bait CDKN2AIPNL Cat. description Hein, Mann, Cell 2015
Category members IP bait CENPE Cat. description Hein, Mann, Cell 2015
Category members IP bait CLTB Cat. description Hein, Mann, Cell 2015
Category members IP bait CLTC Cat. description Hein, Mann, Cell 2015
Category members IP bait DBN1 Cat. description Hein, Mann, Cell 2015
Category members IP bait ELMSAN1 Cat. description Hein, Mann, Cell 2015
Category members IP bait FAM83D Cat. description Hein, Mann, Cell 2015
Category members IP bait FAM83H Cat. description Hein, Mann, Cell 2015
Category members IP bait GAK Cat. description Hein, Mann, Cell 2015
Category members IP bait GORASP1 Cat. description Hein, Mann, Cell 2015
Category members IP bait GTSE1 Cat. description Hein, Mann, Cell 2015
Category members IP bait HNRNPF Cat. description Hein, Mann, Cell 2015
Category members IP bait IQGAP1 Cat. description Hein, Mann, Cell 2015
Category members IP bait KCTD5 Cat. description Hein, Mann, Cell 2015
Category members IP bait KIAA1279 Cat. description Hein, Mann, Cell 2015
Category members IP bait LIMA1 Cat. description Hein, Mann, Cell 2015
Category members IP bait MAPRE1 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYH9 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYO18A Cat. description Hein, Mann, Cell 2015
Category members IP bait MYO19 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYO1C Cat. description Hein, Mann, Cell 2015
Category members IP bait NHSL1 Cat. description Hein, Mann, Cell 2015
Category members IP bait PICALM Cat. description Hein, Mann, Cell 2015
Category members IP bait PPP1CB Cat. description Hein, Mann, Cell 2015
Category members IP bait PRKAR2B Cat. description Hein, Mann, Cell 2015
Category members IP bait SEC16A Cat. description Hein, Mann, Cell 2015
Category members IP bait SEC24C Cat. description Hein, Mann, Cell 2015
Category members IP bait SYNPO Cat. description Hein, Mann, Cell 2015
Category members IP bait TRIM29 Cat. description Hein, Mann, Cell 2015
Category members IP bait USO1 Cat. description Hein, Mann, Cell 2015
Category members IP bait NEFL Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SEC13 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in SEC16A
Domain name Domain Description TC-NER relevance -log10(p-value)


Protein complexes (CORUM database) featuring SEC16A
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Corum 5194 TNF-alpha/NF-kappa B signaling complex (SEC16A, CHUK, IKBKB, NFKB2, REL, IKBKG, MAP3K14, RELA, FBXW7, USP2) Database 0


Categories featuring SEC16A
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005829 cytosol Database INF
Category members GO Category GO:0015031 protein transport Database 3.48
Category members GO Category GO:0005789 endoplasmic reticulum membrane Database 1.57
Category members GO Category GO:0007029 endoplasmic reticulum organization Database 0.05
Category members GO Category GO:0000139 Golgi membrane Database 0
Category members GO Category GO:0048208 COPII vesicle coating Database 0


.

© Copyright Svejstrup Laboratory 2015