bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
SWI/SNF chromatin-remodeling complex
(5184)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
HDAC1 1 -1.980 4.450
HDAC1 1 -1.980 4.450 -0.122 0.307 0.969 0.094 0.191
SMARCE1 0 -0.270 0.280 0.341
SMARCE1 0 -0.270 0.280 0.251 0.796 0.284 0.349
SMARCA2 0 -0.270 0.240 -0.431 -0.133 0.253 0.069 -0.280
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
HDAC1 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC1 Ubiquitylation K66 -0.593 _ANAEEMTK(gl)YHSDDYIK_
HDAC1 Ubiquitylation K74 0.620 -1.473 _YHSDDYIK(gl)FLR_
HDAC1 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC1 Phosphorylation S393 -1.133 -1.144 _M(ox)LPHAPGVQM(ox)QAIPEDAIPEES(ph)GDEDEDDPDKR_
HDAC1 Phosphorylation S409 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Phosphorylation S410 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Ubiquitylation K412 0.642 -0.744 _ISICSSDK(gl)R_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_
SMARCA2 Phosphorylation S329 -0.314 -0.351 _IS(ph)PIQKPQGLDPVEILQER_
SMARCA2 Ubiquitylation K333 -1.365 _ISPIQK(gl)PQGLDPVEILQER_
SMARCA2 Ubiquitylation K381 0.558 1.360 _ATVELK(gl)ALR_
SMARCA2 Ubiquitylation K413 -0.238 _DTTLETALNSK(gl)AYKR_
SMARCA2 Phosphorylation S1377 -0.887 -1.142 _GRPPAEKLS(ph)PNPPK_
SMARCE1 Ubiquitylation K92 0.706 _ASNPDLK(gl)LWEIGK_
SMARCE1 Ubiquitylation K271 -0.418 -0.010 _FLESTDSFNNELK(gl)R_


© Copyright Svejstrup Laboratory 2015