bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
SMN1-SIP1-SNRP complex
(3118)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SNRPD2 1 -1.740 2.880 0.068 -0.598 0.211 0.010 0.140
GEMIN2 0 0.620 -0.610
SNRPD3 0 -0.044 -0.427 0.192
SNRPB 0 -0.690 0.900 0.279 -0.218 0.342 0.246 0.550
SNRPD1 0 -0.780 0.750 0.034 -0.359 0.355 -1.109 -0.252
SMN1 0 -1.430 1.720 0.023 0.246 -1.731
SMN1 0 -0.560 0.640 0.023 0.246 -1.731
SMN2 0 0.023 0.246 -1.731
SNRPE 0 -1.140 2.270 -0.259 -0.638 -0.181 0.064 -0.174

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
GEMIN2 Phosphorylation S81 -0.444 _KQS(ph)VNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVR_
SMN1 Phosphorylation S4 0.158 0.444 _(ac)AMS(ph)SGGSGGGVPEQEDSVLFR_
SMN1 Phosphorylation S5 0.453 0.382 _(ac)AMSS(ph)GGSGGGVPEQEDSVLFR_
SMN1 Phosphorylation S8 0.239 0.738 _(ac)AMSSGGS(ph)GGGVPEQEDSVLFR_
SMN1 Phosphorylation T25 1.306 0.581 _GT(ph)GQSDDSDIWDDTALIK_
SMN1 Phosphorylation S28 0.885 0.944 _GTGQS(ph)DDSDIWDDTALIK_
SMN1 Phosphorylation S31 0.980 _RGTGQSDDS(ph)DIWDDTALIK_
SMN1 Ubiquitylation K45 0.101 1.114 _AYDK(gl)AVASFK_
SMN1 Ubiquitylation K51 -0.448 _AVASFK(gl)HALK_
SMN1 Ubiquitylation K65 -0.724 _NGDICETSGK(gl)PK_
SMN1 Ubiquitylation K83 -0.049 -0.330 _K(gl)NTAASLQQWK_
SMN1 Ubiquitylation K93 0.896 _NTAASLQQWK(gl)VGDK_
SMN1 Ubiquitylation K179 -1.678 _SPGNK(gl)SDNIKPK_
SMN1 Ubiquitylation K209 -0.581 -0.285 _LGPGK(gl)PGLK_
SMN2 Phosphorylation S4 0.158 0.444 _(ac)AMS(ph)SGGSGGGVPEQEDSVLFR_
SMN2 Phosphorylation S5 0.453 0.382 _(ac)AMSS(ph)GGSGGGVPEQEDSVLFR_
SMN2 Phosphorylation S8 0.239 0.738 _(ac)AMSSGGS(ph)GGGVPEQEDSVLFR_
SMN2 Phosphorylation T25 1.306 0.581 _GT(ph)GQSDDSDIWDDTALIK_
SMN2 Phosphorylation S28 0.885 0.944 _GTGQS(ph)DDSDIWDDTALIK_
SMN2 Phosphorylation S31 0.980 _RGTGQSDDS(ph)DIWDDTALIK_
SMN2 Ubiquitylation K45 0.101 1.114 _AYDK(gl)AVASFK_
SMN2 Ubiquitylation K51 -0.448 _AVASFK(gl)HALK_
SMN2 Ubiquitylation K65 -0.724 _NGDICETSGK(gl)PK_
SMN2 Ubiquitylation K83 -0.049 -0.330 _K(gl)NTAASLQQWK_
SMN2 Ubiquitylation K93 0.896 _NTAASLQQWK(gl)VGDK_
SMN2 Ubiquitylation K179 -1.678 _SPGNK(gl)SDNIKPK_
SMN2 Ubiquitylation K209 -0.581 -0.285 _LGPGK(gl)PGLK_
SNRPB Ubiquitylation K8 0.805 _SSK(gl)MLQHIDYR_
SNRPB Ubiquitylation K32 0.987 _IFIGTFK(gl)_
SNRPB Ubiquitylation K88 -0.870 _GENLVSMTVEGPPPK(gl)DTGIAR_
SNRPD1 Ubiquitylation K44 0.032 _AVK(gl)MTLK_
SNRPD2 Phosphorylation S2 -0.117 0.507 _(ac)S(ph)LLNKPK_
SNRPD2 Ubiquitylation K6 -0.352 _(ac)SLLNK(gl)PK_
SNRPD2 Ubiquitylation K8 -0.201 -0.603 _(ac)SLLNKPK(gl)SEMTPEELQK_
SNRPD2 Phosphorylation T12 0.766 _SEMT(ph)PEELQKR_
SNRPD2 Ubiquitylation K98 0.883 0.887 _YISK(gl)MFLR_
SNRPD2 Ubiquitylation K118 -0.918 -0.587 _NPLIAGK(gl)_
SNRPD3 Ubiquitylation K78 0.797 _FLILPDMLK(gl)NAPMLK_
SNRPD3 Ubiquitylation K84 -0.440 0.082 _NAPMLK(gl)SMK_


© Copyright Svejstrup Laboratory 2015