bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: TPT1

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
TPT1 0 -0.351 0.360 -0.510 -0.570 -0.005

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
TPT1 Ubiquitylation K112 0.114 0.269 _VK(gl)PFMTGAAEQIK_
TPT1 Ubiquitylation K102 -0.063 _GK(gl)LEEQRPER_
TPT1 Phosphorylation T39 -0.158 _T(ph)EGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTK_
TPT1 Phosphorylation S53 -1.046 _TEGNIDDSLIGGNAS(ph)AEGPEGEGTESTVITGVDIVMNHHLQETSFTK_

Background Information for TPT1:


Pubmed-TPT1 »
Uniprot-TPT1 »
Biogrid-TPT1 »
ProteomicsDB-TPT1 »

Tumorportal-TPT1 »
COSMIC-TPT1 »
GenomeRNAi-TPT1 »
Genecards-TPT1


Protein-protein Interactions for TPT1
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait TPT1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in TPT1
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members Mss4-like IPR011057 0.78


Protein complexes (CORUM database) featuring TPT1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring TPT1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005654 nucleoplasm Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0005615 extracellular space Database 4.72
Category members DDR Literature pubmedid:19647519 Paulsen et al., 2009 siRNA screen for g-H2A.x phosphorylation 3.6
Category members GO Category GO:0042981 regulation of apoptotic process Database 0.79
Category members GO Category GO:0043066 negative regulation of apoptotic process Database 0.6
Category members GO Category GO:0019827 stem cell maintenance Database 0.48
Category members GO Category GO:0008134 transcription factor binding Database 0.37
Category members Pathway Pathway_1028 PID_PLK1_PATHWAY 0 0.16
Category members GO Category GO:0005509 calcium ion binding Database 0.11
Category members GO Category GO:0005771 multivesicular body Database 0
Category members GO Category GO:0006816 calcium ion transport Database 0
Category members GO Category GO:0006874 cellular calcium ion homeostasis Database 0
Category members GO Category GO:0009615 response to virus Database 0
Category members GO Category GO:0045298 tubulin complex Database 0


.

© Copyright Svejstrup Laboratory 2015