bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: MGA

This is a cancer-associated gene according to the Broad cancer gene census.

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
MGA 3 8.097 -1.560 2.090 0.052 0.179
MGA 3 8.097 -1.560 2.090 -0.565 -0.808 -0.186 -0.167 0.160

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
MGA Phosphorylation S449 2.321 3.511 _WLPSS(ph)PSGVAK_
MGA Phosphorylation S1208 1.646 1.566 _LLTGIKS(ph)PR_
MGA Phosphorylation S2898 -0.139 -0.119 _ELPDVQGESDSIS(ph)PLLLHLEDDDFSENEK_
MGA Phosphorylation S56 0.206 -0.462 _TDQGILVTNQDACALASSVSS(ph)PVK_
MGA Phosphorylation S924 -0.700 -0.785 _SILPYPVS(ph)PK_
MGA Phosphorylation S645 -0.802 _NTPVS(ph)PGSTFPDVKPDLEDVDGVLFVSFESK_
MGA Ubiquitylation K817 0.432 -0.999 _NEGGNSESSLK(gl)NR_
MGA Phosphorylation S2620 -1.069 _GPLFSGPVVAVS(ph)PDLLESDLKPQVAGSAVALPENDDLFMMPR_
MGA Ubiquitylation K715 1.514 _ELIEDLK(gl)TLR_
MGA Ubiquitylation K791 1.310 _TNDFTK(gl)IK_
MGA Ubiquitylation K1201 -0.386 _GK(gl)LLTGIK_
MGA Ubiquitylation K1207 -0.851 _LLTGIK(gl)SPR_
MGA Phosphorylation S2910 -0.546 _ELPDVQGESDSISPLLLHLEDDDFS(ph)ENEK_

Background Information for MGA:


Pubmed-MGA »
Uniprot-MGA »
Biogrid-MGA »
ProteomicsDB-MGA »

Tumorportal-MGA »
COSMIC-MGA »
GenomeRNAi-MGA »
Genecards-MGA


Protein-protein Interactions for MGA
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait CBX1 Cat. description Hein, Mann, Cell 2015
Category members IP bait CBX7 Cat. description Hein, Mann, Cell 2015
Category members IP bait DYNC1LI1 Cat. description Hein, Mann, Cell 2015
Category members IP bait HDAC1 Cat. description Hein, Mann, Cell 2015
Category members IP bait JARID1C;KDM5C Cat. description Hein, Mann, Cell 2015
Category members IP bait L3MBTL2 Cat. description Hein, Mann, Cell 2015
Category members IP bait MAX Cat. description Hein, Mann, Cell 2015
Category members IP bait RING1 Cat. description Hein, Mann, Cell 2015
Category members IP bait RNF2 Cat. description Hein, Mann, Cell 2015
Category members IP bait RPL35 Cat. description Hein, Mann, Cell 2015
Category members IP bait WDR5 Cat. description Hein, Mann, Cell 2015
Category members IP bait ZMYND8 Cat. description Hein, Mann, Cell 2015
Category members IP bait ASB6 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CARD8 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CDC16 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CDH19 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait DYNC1I1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait E2F6 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait HDAC1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait KBTBD5 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait L3MBTL2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait MIER2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait MLX Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PCGF6 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PSMC3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PSME3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait RFPL4B Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait RYBP Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait WBP2NL Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait WDR5 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait YAF2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait ZNF692 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in MGA
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members bHLH_dom IPR011598 0.32
Category members TF_T-box IPR001699 0
Category members p53-like_TF_DNA-bd IPR008967 0


Protein complexes (CORUM database) featuring MGA
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring MGA
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0003677 DNA binding Database 1.53
Category members Human mutations Broad_cancer_genes Broad cancer genes (Lawrence et al., 2014) literature 1.14
Category members GO Category GO:0006351 transcription, DNA-templated Database 1.07
Category members GO Category GO:0003700 sequence-specific DNA binding transcription factor activity Database 0.63
Category members GO Category GO:0071339 MLL1 complex Database 0.45
Category members GO Category GO:0005667 transcription factor complex Database 0.19
Category members GO Category GO:0006355 regulation of transcription, DNA-dependent Database 0
Category members GO Category GO:0046983 protein dimerization activity Database 0


.

© Copyright Svejstrup Laboratory 2015