bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: DGCR8

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
DGCR8 0 1.436 0.120 -0.650

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
DGCR8 Phosphorylation S153 0.657 _AECGLLLS(ph)PVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEK_
DGCR8 Phosphorylation S377 -0.073 -0.076 _EQSSDLTPSGDVS(ph)PVKPLSR_
DGCR8 Phosphorylation S8 -0.636 -0.088 _(ac)METDESPS(ph)PLPCGPAGEAVMESR_
DGCR8 Phosphorylation S383 0.779 -0.513 _DNEEREQSSDLTPSGDVSPVKPLS(ph)R_
DGCR8 Phosphorylation S95 -0.534 -0.986 _LLIDPNCSGHS(ph)PR_

Background Information for DGCR8:


Pubmed-DGCR8 »
Uniprot-DGCR8 »
Biogrid-DGCR8 »
ProteomicsDB-DGCR8 »

Tumorportal-DGCR8 »
COSMIC-DGCR8 »
GenomeRNAi-DGCR8 »
Genecards-DGCR8


Protein-protein Interactions for DGCR8
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait CTR9 Cat. description Hein, Mann, Cell 2015
Category members IP bait DGCR8 Cat. description Hein, Mann, Cell 2015
Category members IP bait FAM46A Cat. description Hein, Mann, Cell 2015
Category members IP bait FANCI Cat. description Hein, Mann, Cell 2015
Category members IP bait HSF1 Cat. description Hein, Mann, Cell 2015
Category members IP bait KIF11 Cat. description Hein, Mann, Cell 2015
Category members IP bait KLF8 Cat. description Hein, Mann, Cell 2015
Category members IP bait MCM3 Cat. description Hein, Mann, Cell 2015
Category members IP bait NFYA Cat. description Hein, Mann, Cell 2015
Category members IP bait SAMM50 Cat. description Hein, Mann, Cell 2015
Category members IP bait SMC6 Cat. description Hein, Mann, Cell 2015
Category members IP bait SYN1 Cat. description Hein, Mann, Cell 2015
Category members IP bait TAF15 Cat. description Hein, Mann, Cell 2015
Category members IP bait TFG Cat. description Hein, Mann, Cell 2015
Category members IP bait TMED10 Cat. description Hein, Mann, Cell 2015
Category members IP bait UFL1 Cat. description Hein, Mann, Cell 2015
Category members IP bait ZWINT Cat. description Hein, Mann, Cell 2015
Category members IP bait DGCR8 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait MECP2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait ZBTB48 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait ZNF324B Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in DGCR8
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members WW_dom IPR001202 1.15
Category members dsRNA-bd_dom IPR014720 0.23


Protein complexes (CORUM database) featuring DGCR8
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Corum 1332 Large Drosha complex Database 0.08
Category members Corum 3082 DGCR8 multiprotein complex Database 0.07
Category members Corum 3078 DGCR8-NCL complex Database 0.04
Category members Corum 3056 Microprocessor complex Database 0
Category members Corum 3079 DGCR8-ILF3 complex Database 0
Category members Corum 3081 Microprocessor complex Database 0


Categories featuring DGCR8
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005654 nucleoplasm Database INF
Category members GO Category GO:0010467 gene expression Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0015630 microtubule cytoskeleton Database 1.34
Category members Pathway Pathway_383 PID_P53_DOWNSTREAM_PATHWAY 0 0.23
Category members Pathway Pathway_368 REACTOME_MICRORNA_MIRNA_BIOGENESIS 0 0.18
Category members Pathway Pathway_379 REACTOME_REGULATORY_RNA_PATHWAYS 0 0.12
Category members GO Category GO:0003725 double-stranded RNA binding Database 0.1
Category members GO Category GO:0031053 primary miRNA processing Database 0.08
Category members GO Category GO:0046872 metal ion binding Database 0


.

© Copyright Svejstrup Laboratory 2015