bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
DGCR8-NCL complex
(3078)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
NCL 3 -0.530 0.500 -0.279 -0.044 0.135
DGCR8 0 0.120 -0.650

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
DGCR8 Phosphorylation S8 -0.636 -0.088 _(ac)METDESPS(ph)PLPCGPAGEAVMESR_
DGCR8 Phosphorylation S95 -0.534 -0.986 _LLIDPNCSGHS(ph)PR_
DGCR8 Phosphorylation S153 0.657 _AECGLLLS(ph)PVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEK_
DGCR8 Phosphorylation S377 -0.073 -0.076 _EQSSDLTPSGDVS(ph)PVKPLSR_
DGCR8 Phosphorylation S383 0.779 -0.513 _DNEEREQSSDLTPSGDVSPVKPLS(ph)R_
NCL Phosphorylation S67 0.084 0.215 _VVVS(ph)PTKK_
NCL Phosphorylation T69 0.262 0.250 _KVVVSPT(ph)KK_
NCL Ubiquitylation K70 0.073 _KVVVSPTK(gl)K_
NCL Ubiquitylation K71 0.073 _KVVVSPTK(gl)K_
NCL Phosphorylation T76 -0.311 -1.653 _KVAVAT(ph)PAK_
NCL Ubiquitylation K102 0.229 _TVTPAK(gl)AVTTPGKK_
NCL Ubiquitylation K116 0.184 _GATPGK(gl)ALVATPGKK_
NCL Phosphorylation T121 -0.434 -0.594 _ALVAT(ph)PGKK_
NCL Ubiquitylation K135 0.162 _GAAIPAKGAK(gl)_
NCL Ubiquitylation K324 1.129 _SAPELK(gl)TGISDVFAK_
NCL Ubiquitylation K333 1.065 _TGISDVFAK(gl)NDLAVVDVR_
NCL Ubiquitylation K377 0.914 _VFGNEIK(gl)LEKPK_
NCL Ubiquitylation K380 1.047 _VFGNEIKLEK(gl)PK_
NCL Ubiquitylation K398 0.982 1.070 _TLLAK(gl)NLPYK_
NCL Ubiquitylation K403 1.073 _NLPYK(gl)VTQDELK_
NCL Ubiquitylation K429 1.523 _SK(gl)GIAYIEFK_
NCL Ubiquitylation K467 1.082 _SISLYYTGEK(gl)GQNQDYR_
NCL Ubiquitylation K513 1.291 -0.285 _ATFIK(gl)VPQNQNGK_
NCL Phosphorylation S563 -0.006 0.046 _LELQGPRGS(ph)PNAR_
NCL Phosphorylation S580 1.509 0.943 _GLS(ph)EDTTEETLK_
NCL Ubiquitylation K589 0.843 _GLSEDTTEETLK(gl)ESFDGSVR_
NCL Phosphorylation S619 1.522 1.942 _GFGFVDFNS(ph)EEDAK_


© Copyright Svejstrup Laboratory 2015