bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
long-term synaptic potentiation
(GO:0060291)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
ITPR3 2 -0.190 -0.500 1.489 1.835
PRKCZ 0 -0.290 0.310
GFAP 0 0.930 -0.340 0.523 -5.250
PLK2 0 0.900 -0.790
NPTN 0 0.600 -0.750 0.647 0.525

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ITPR3 Ubiquitylation K529 1.377 _EK(gl)GGEGPLVR_
ITPR3 Phosphorylation S934 0.318 -0.802 _KQS(ph)VFSAPSLSAGASAAEPLDR_
ITPR3 Phosphorylation S937 -0.026 _KQSVFS(ph)APSLSAGASAAEPLDR_
ITPR3 Ubiquitylation K1534 -0.220 _TLAMVAK(gl)GR_
ITPR3 Phosphorylation S1832 0.650 0.560 _VAS(ph)FSIPGSSSR_
ITPR3 Ubiquitylation K2597 -0.819 _NK(gl)NLDWFPR_
ITPR3 Ubiquitylation K2628 -0.010 _ILQDK(gl)LNSTMK_
ITPR3 Phosphorylation S2670 1.132 1.555 _LGFVDVQNCIS(ph)R_
NPTN Ubiquitylation K244 -0.393 _AAPDITGHK(gl)R_
NPTN Ubiquitylation K249 0.185 _SENK(gl)NEGQDATMYCK_
PLK2 Ubiquitylation K438 -0.272 _SGTPAVENK(gl)QQIGDAIR_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_


© Copyright Svejstrup Laboratory 2015