Results for the Category
negative regulation of hydrolase activity
(GO:0051346)
| RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
| W | |||||||
| Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
|---|---|---|---|---|---|---|---|---|
| ATPIF1 | 1 | 1.050 | -0.290 | |||||
| PRKCZ | 0 | -0.290 | 0.310 | |||||
| LEPR | 0 | -0.050 | 0.330 | |||||
| APOA1 | 0 | 0.850 | -0.420 | -3.959 |
| Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
|---|---|---|---|---|---|
| ATPIF1 | Ubiquitylation | K49 | -0.191 | 0.324 | _EAGGAFGK(gl)R_ |
| ATPIF1 | Ubiquitylation | K72 | 3.495 | _EQLAALKK(gl)_ | |
| LEPR | Ubiquitylation | K592 | 0.126 | _MYEVYDAK(gl)SK_ | |
| LEPR | Ubiquitylation | K594 | 0.126 | _MYEVYDAK(gl)SK_ | |
| PRKCZ | Phosphorylation | T560 | -0.884 | -1.578 | _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_ |
.
© Copyright Svejstrup Laboratory 2015