bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
positive regulation of insulin receptor signaling pathway
(GO:0046628)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
PRKCZ 0 -0.290 0.310
OSBPL8 0 0.270 -0.840 -1.590 -0.451 0.036 0.268
SIRT1 0 0.910 -0.910
ADIPOR1 0 -0.720 0.740
IRS1 0

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ADIPOR1 Ubiquitylation K137 -0.271 _ACFK(gl)SIFR_
IRS1 Phosphorylation S1101 -0.078 _HSS(ph)ETFSSTPSATR_
OSBPL8 Phosphorylation T13 0.040 _(ac)M(ox)EGGLADGEPDRT(ph)SLLGDSKDVLGPSTVVANSDESQLLTPGK_
OSBPL8 Phosphorylation S14 0.237 0.627 _(ac)MEGGLADGEPDRTS(ph)LLGDSK_
OSBPL8 Phosphorylation T39 -0.210 _DVLGPSTVVANSDESQLLT(ph)PGK_
OSBPL8 Phosphorylation S63 -0.125 0.863 _DLHQPS(ph)LSPASPHSQGFER_
OSBPL8 Phosphorylation S65 -0.155 0.044 _DLHQPSLS(ph)PASPHSQGFER_
OSBPL8 Phosphorylation S68 -0.891 -0.231 _DLHQPSLSPAS(ph)PHSQGFER_
OSBPL8 Phosphorylation S71 0.689 _DLHQPSLSPASPHS(ph)QGFER_
OSBPL8 Phosphorylation S120 1.496 1.221 _KES(ph)LKVQK_
OSBPL8 Ubiquitylation K698 0.085 -0.077 _AINAK(gl)DQTEATQEK_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
SIRT1 Phosphorylation S14 -0.369 -0.246 _(ac)ADEAALALQPGGS(ph)PSAAGADR_
SIRT1 Phosphorylation S16 -0.306 -1.665 _(ac)ADEAALALQPGGS(ph)PS(ph)AAGADREAASSPAGEPLR_
SIRT1 Phosphorylation S26 -1.047 -0.245 _EAAS(ph)SPAGEPLR_
SIRT1 Phosphorylation S27 0.351 -0.363 _EAASS(ph)PAGEPLR_
SIRT1 Phosphorylation S47 -0.574 -0.607 _S(ph)PGEPGGAAPER_
SIRT1 Ubiquitylation K238 -1.641 _RK(gl)DINTIEDAVK_
SIRT1 Ubiquitylation K499 -2.138 -0.204 _LGGEYAK(gl)LCCNPVK_
SIRT1 Ubiquitylation K578 -2.782 _GCMEEK(gl)PQEVQTSR_
SIRT1 Ubiquitylation K601 -3.051 _NVESIAEQMENPDLK(gl)NVGSSTGEK_


© Copyright Svejstrup Laboratory 2015