Results for the Category
positive regulation of interleukin-4 production
(GO:0032753)
| RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
| W | |||||||
| Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
|---|---|---|---|---|---|---|---|---|
| PRKCQ | 0 | 0.410 | 0.020 | |||||
| PRKCZ | 0 | -0.290 | 0.310 | |||||
| GATA3 | 0 | 0.000 | -0.660 |
| Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
|---|---|---|---|---|---|
| GATA3 | Phosphorylation | S162 | -1.195 | -0.563 | _DVS(ph)PDPSLSTPGSAGSAR_ |
| PRKCQ | Phosphorylation | S685 | 0.911 | _ALINS(ph)MDQNMFR_ | |
| PRKCZ | Phosphorylation | T560 | -0.884 | -1.578 | _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_ |
.
© Copyright Svejstrup Laboratory 2015