bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
MutS-alpha-PK-zeta complex
(2226)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
MSH6 2 -0.410 0.140 -0.115 0.232 0.645 0.407 0.101
MSH2 1 -0.130 0.010 0.224 0.457 0.838 0.840 0.366
PRKCZ 0 -0.290 0.310

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
MSH2 Ubiquitylation K212 -0.233 _ECVLPGGETAGDMGK(gl)LR_
MSH2 Ubiquitylation K249 0.461 _K(gl)GEQMNSAVLPEMENQVAVSSLSAVIK_
MSH2 Ubiquitylation K347 2.867 _LVNQWIK(gl)QPLMDK_
MSH2 Ubiquitylation K531 1.040 _VTCKEEK(gl)VLR_
MSH2 Ubiquitylation K555 0.164 _FTNSK(gl)LTSLNEEYTK_
MSH2 Ubiquitylation K635 -0.376 _IILK(gl)ASR_
MSH6 Phosphorylation S41 -0.708 -0.948 _AAAAPGAS(ph)PSPGGDAAWSEAGPGPRPLAR_
MSH6 Phosphorylation S43 0.319 -0.234 _AAAAPGASPS(ph)PGGDAAWSEAGPGPR_
MSH6 Phosphorylation S137 0.203 0.359 _VHVQFFDDS(ph)PTR_
MSH6 Phosphorylation T139 0.209 _VHVQFFDDSPT(ph)R_
MSH6 Phosphorylation S227 -0.199 -0.192 _SEEDNEIES(ph)EEEVQPK_
MSH6 Ubiquitylation K334 0.193 _QATSISSETK(gl)NTLR_
MSH6 Ubiquitylation K476 1.536 0.184 _YSDSLVQK(gl)GYK_
MSH6 Ubiquitylation K519 2.264 0.186 _IITK(gl)GTQTYSVLEGDPSENYSK_
MSH6 Ubiquitylation K728 0.082 -0.280 _SGAIFTK(gl)AYQR_
MSH6 Ubiquitylation K771 -0.582 -1.069 _VDTCHTPFGK(gl)R_
MSH6 Phosphorylation S830 0.130 1.666 _IHNVGS(ph)PLK_
MSH6 Ubiquitylation K852 -0.044 _AIMYEETTYSK(gl)K_
MSH6 Ubiquitylation K853 -0.044 _AIMYEETTYSK(gl)K_
MSH6 Ubiquitylation K896 -0.342 _QVISLQTK(gl)NPEGR_
MSH6 Ubiquitylation K997 -0.863 _NLPEEYELK(gl)STK_
MSH6 Ubiquitylation K1009 -0.817 _YWTK(gl)TIEK_
MSH6 Ubiquitylation K1030 0.394 -0.156 _DVSLK(gl)DCMR_
MSH6 Ubiquitylation K1240 -0.672 _ELAETIK(gl)CR_
MSH6 Ubiquitylation K1291 0.633 _FIK(gl)GACPK_
MSH6 Ubiquitylation K1296 -1.142 _GACPK(gl)SYGFNAAR_
MSH6 Ubiquitylation K1315 -1.738 _LANLPEEVIQK(gl)GHR_
MSH6 Ubiquitylation K1325 -0.190 _EFEK(gl)MNQSLR_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_


© Copyright Svejstrup Laboratory 2015