bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
REST-CoREST-mSIN3A complex
(1232)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
RCOR1 2 -1.890 3.100 0.185 -0.123 0.523 0.896 0.794
REST 0 -0.120 -0.050 -0.002 -1.235 -0.636
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
RCOR1 Phosphorylation S124 0.641 _S(ph)QERDNLGMLVWSPNQNLSEAK_
RCOR1 Ubiquitylation K156 1.766 _LDEYIAIAKEK(gl)_
RCOR1 Phosphorylation S257 -0.356 _REREES(ph)EDELEEANGNNPIDIEVDQNK_
REST Ubiquitylation K280 0.406 _VYTCGK(gl)CNYFSDR_
REST Phosphorylation S864 -3.456 _ESVSTEDLSPPS(ph)PPLPK_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_


© Copyright Svejstrup Laboratory 2015