bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: SHROOM1

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
SHROOM1 1 2.347 1.810 -0.700

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
SHROOM1 Phosphorylation S308 0.201 _SAS(ph)GEVLGSWGGSGGTIPIVQAVPQGAETPRPLFQTK_
SHROOM1 Phosphorylation S188 2.146 0.126 _SAS(ph)LSHPGGEGEPAR_

Background Information for SHROOM1:


Pubmed-SHROOM1 »
Uniprot-SHROOM1 »
Biogrid-SHROOM1 »
ProteomicsDB-SHROOM1 »

Tumorportal-SHROOM1 »
COSMIC-SHROOM1 »
GenomeRNAi-SHROOM1 »
Genecards-SHROOM1


Protein-protein Interactions for SHROOM1
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait NYX Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in SHROOM1
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members ASD2 IPR014799 0
Category members ASD1 IPR014800 0


Protein complexes (CORUM database) featuring SHROOM1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring SHROOM1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0005874 microtubule Database 1.21
Category members GO Category GO:0051015 actin filament binding Database 0.99
Category members GO Category GO:0051017 actin filament bundle assembly Database 0.47
Category members GO Category GO:0016460 myosin II complex Database 0.03
Category members GO Category GO:0000902 cell morphogenesis Database 0


.

© Copyright Svejstrup Laboratory 2015