bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: OSBPL6

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
OSBPL6 0 1.274 0.220 -0.850

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
OSBPL6 Phosphorylation S44 -0.017 0.896 _TAS(ph)SSTEPSVSR_
OSBPL6 Phosphorylation S32 0.378 0.355 _DS(ph)RQSIHILER_
OSBPL6 Phosphorylation S343 -0.917 _LHS(ph)SNPNLCADIEFQTPPSHLTDPLESSTDYTK_
OSBPL6 Phosphorylation S344 -1.161 -1.376 _LHSS(ph)NPNLCADIEFQTPPSHLTDPLESSTDYTK_

Background Information for OSBPL6:


Pubmed-OSBPL6 »
Uniprot-OSBPL6 »
Biogrid-OSBPL6 »
ProteomicsDB-OSBPL6 »

Tumorportal-OSBPL6 »
COSMIC-OSBPL6 »
GenomeRNAi-OSBPL6 »
Genecards-OSBPL6


Protein-protein Interactions for OSBPL6
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait VAPA Cat. description Hein, Mann, Cell 2015
Category members IP bait ARRDC1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait AURKA Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait AZU1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait BLVRA Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait GLTSCR2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait ILVBL Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait JPH4 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait MIS18A Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait NUPL1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SLC2A5 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TMED2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TRAF1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait VAPA Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait VAPB Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait ZFPL1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait ZNF414 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in OSBPL6
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members PH_domain IPR001849 0.14
Category members Oxysterol-bd IPR000648 0


Protein complexes (CORUM database) featuring OSBPL6
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring OSBPL6
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005829 cytosol Database INF
Category members GO Category GO:0031965 nuclear membrane Database 2.59
Category members GO Category GO:0005886 plasma membrane Database 1.21
Category members GO Category GO:0006869 lipid transport Database 0
Category members GO Category GO:0008289 lipid binding Database 0


.

© Copyright Svejstrup Laboratory 2015