bioLOGIC Data
Query: KIAA1467
| RNAi screen result | RNAPII IP (PI) | CSB IP | CSB IP (PI) | Chrom. | Chrom. (PI) | Phosphorylation | Ubiquitylation |
| W | |||||||
[Click on the plots to view the data selection in the respective scatterplot]
Protein Results:
Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen| Gene name | Point score | Z-score sums | RNAi high | RNAi low | RNAPII-IP (PI) | CSB-IP | CSB-IP (PI) | Chrom. | Chrom. (PI) |
|---|---|---|---|---|---|---|---|---|---|
| KIAA1467 | 0 | -3.131 | 0.100 | -0.310 |
PTM Sites:
Back to Protein Results | Red/green: hit at lower/upper end of the respective screen| Gene name | PTM type | PTM site | UV | UV (PI) | Sequence |
|---|---|---|---|---|---|
| KIAA1467 | Phosphorylation | S62 | -1.648 | -1.483 | _SPLGEAPEPDS(ph)DAEVAEAAKPHLSEVTTEGYPSEPLGGLEQK_ |