bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Data

bioLOGIC Data


Exact search

Query: DCBLD1

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
DCBLD1 0 -0.289 0.970 -0.850

PTM Sites:

Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
DCBLD1 Phosphorylation S633 -0.565 _HS(ph)LSSGGFSPVAGVGAQDGDYQRPHSAQPADR_
DCBLD1 Phosphorylation S640 0.276 _HSLSSGGFS(ph)PVAGVGAQDGDYQRPHSAQPADR_

Background Information for DCBLD1:





Protein-protein Interactions for DCBLD1

Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait HLA-DPA1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PCDH12 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TNFSF8 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in DCBLD1

Domain name Domain Description TC-NER relevance -log10(p-value)
Category members Coagulation_fac_5/8-C_type_dom IPR000421 0.13
Category members CUB_dom IPR000859 0.04
Category members LCCL IPR004043 0
Category members Galactose-bd-like IPR008979 0


Protein complexes (CORUM database) featuring DCBLD1

Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring DCBLD1

Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0016021 integral to membrane Database 7.67
Category members GO Category GO:0007155 cell adhesion Database 0


© Copyright Svejstrup Laboratory 2015