bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: ASXL2

This is a cancer-associated gene according to the Broad cancer gene census.

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
ASXL2 0 1.644 0.030 0.540

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
ASXL2 Phosphorylation S1571 1.090 _FCLSS(ph)PTEALK_
ASXL2 Phosphorylation S812 0.946 _KLTAS(ph)PSDPK_
ASXL2 Ubiquitylation K342 0.443 _IRQEIEK(gl)EK_
ASXL2 Phosphorylation S941 -0.429 -0.219 _SESQESLVTS(ph)PSKPK_
ASXL2 Phosphorylation S1701 -1.409 _S(ph)SPELFSSTVLPLPADSPTHQPLLLPPLQTPK_
ASXL2 Phosphorylation S1702 -1.409 _S(ph)SPELFSSTVLPLPADSPTHQPLLLPPLQTPK_

Background Information for ASXL2:


Pubmed-ASXL2 »
Uniprot-ASXL2 »
Biogrid-ASXL2 »
ProteomicsDB-ASXL2 »

Tumorportal-ASXL2 »
COSMIC-ASXL2 »
GenomeRNAi-ASXL2 »
Genecards-ASXL2


Protein-protein Interactions for ASXL2
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait EXOSC2 Cat. description Hein, Mann, Cell 2015
Category members IP bait KDM1B Cat. description Hein, Mann, Cell 2015
Category members IP bait RAB5B Cat. description Hein, Mann, Cell 2015
Category members IP bait TMEM109 Cat. description Hein, Mann, Cell 2015
Category members IP bait ZNF673 Cat. description Hein, Mann, Cell 2015
Category members IP bait ASXL2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in ASXL2
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members Znf_FYVE_PHD IPR011011 1.23


Protein complexes (CORUM database) featuring ASXL2
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring ASXL2
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0003677 DNA binding Database 1.53
Category members Human mutations Broad_cancer_genes Broad cancer genes (Lawrence et al., 2014) literature 1.14
Category members GO Category GO:0006351 transcription, DNA-templated Database 1.07
Category members GO Category GO:0045944 positive regulation of transcription from RNA polymerase II promoter Database 0.13
Category members GO Category GO:0042975 peroxisome proliferator activated receptor binding Database 0.05
Category members GO Category GO:0006355 regulation of transcription, DNA-dependent Database 0
Category members GO Category GO:0035360 positive regulation of peroxisome proliferator activated receptor signaling pathway Database 0
Category members GO Category GO:0045600 positive regulation of fat cell differentiation Database 0
Category members GO Category GO:0046872 metal ion binding Database 0


.

© Copyright Svejstrup Laboratory 2015