Results for the Category
positive regulation of peroxisome proliferator activated receptor signaling pathway
(GO:0035360)
| RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
| W | |||||||
| Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
|---|---|---|---|---|---|---|---|---|
| ASXL2 | 0 | 0.030 | 0.540 | |||||
| ASXL2 | 0 | 0.030 | 0.540 | |||||
| ALOX15B | 0 |
| Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
|---|---|---|---|---|---|
| ALOX15B | Ubiquitylation | K214 | 0.144 | _SLNEMK(gl)R_ | |
| ASXL2 | Ubiquitylation | K342 | 0.443 | _IRQEIEK(gl)EK_ | |
| ASXL2 | Phosphorylation | S812 | 0.946 | _KLTAS(ph)PSDPK_ | |
| ASXL2 | Phosphorylation | S941 | -0.429 | -0.219 | _SESQESLVTS(ph)PSKPK_ |
| ASXL2 | Phosphorylation | S1571 | 1.090 | _FCLSS(ph)PTEALK_ | |
| ASXL2 | Phosphorylation | S1701 | -1.409 | _S(ph)SPELFSSTVLPLPADSPTHQPLLLPPLQTPK_ | |
| ASXL2 | Phosphorylation | S1702 | -1.409 | _S(ph)SPELFSSTVLPLPADSPTHQPLLLPPLQTPK_ |
.
© Copyright Svejstrup Laboratory 2015