bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
REACTOME_P38MAPK_EVENTS
(Pathway_1117)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
MAPK14 2 -0.160 -0.350
KRAS 1 -0.510 0.620 1.031 0.887
KRAS 1 -0.510 0.620 0.246 -0.346
NRAS 1 1.810 -0.720 0.246 -0.346
RALA 0 -0.480 0.600 0.727 0.398
RALB 0 -0.960 2.060
HRAS 0 1.470 -0.520
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
KRAS Ubiquitylation K128 1.528 1.433 _TVDTK(gl)QAHELAK_
KRAS Ubiquitylation K235 0.591 0.087 _TVDTK(gl)QAQDLAR_
KRAS Ubiquitylation K254 -0.450 -0.156 _SYGIPFIETSAK(gl)TR_
MAPK14 Phosphorylation S2 3.221 3.623 _(ac)S(ph)QERPTFYR_
MAPK14 Phosphorylation T180 0.958 1.087 _HTDDEM(ox)T(ph)GYVATR_
MAPK14 Phosphorylation Y182 1.388 1.374 _HTDDEM(ox)TGY(ph)VATR_
MAPK14 Ubiquitylation K249 0.073 -1.380 _LVGTPGAELLKK(gl)_
NRAS Ubiquitylation K128 1.528 1.433 _TVDTK(gl)QAHELAK_
RALA Ubiquitylation K7 0.700 _(ac)AANKPK(gl)GQNSLALHK_
RALA Ubiquitylation K134 0.656 -0.585 _SDLEDK(gl)RQVSVEEAK_
RALA Ubiquitylation K143 -0.388 _QVSVEEAK(gl)NR_
RALB Ubiquitylation K29 0.645 _SK(gl)GQSSLALHK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_


© Copyright Svejstrup Laboratory 2015