bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
negative regulation of protein kinase activity by regulation of protein phosphorylation
(GO:0044387)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
ADAR 1 -0.700 1.260 -0.595 -2.524 -1.253 -1.530 -0.195
ADAR 1 -0.700 1.260 0.674 -0.016
NPM1 1 1.010 -0.750 0.063 -0.066 -0.259

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ADAR Ubiquitylation K427 -0.338 _NTNSVPETAPAAIPETK(gl)R_
ADAR Phosphorylation T644 2.146 1.082 _TAESQT(ph)PTPSATSFFSGK_
ADAR Phosphorylation S657 0.046 _S(ph)PVTTLLECMHK_
ADAR Ubiquitylation K680 -0.527 _LLSK(gl)EGPAHEPK_
ADAR Ubiquitylation K841 1.158 _VLIGENEK(gl)AER_
ADAR Phosphorylation S866 0.195 _TMLLLS(ph)RSPEAQPK_
ADAR Ubiquitylation K987 -0.367 _DSIFEPAK(gl)GGEK_
ADAR Ubiquitylation K991 -0.367 _DSIFEPAK(gl)GGEK_
ADAR Ubiquitylation K1158 1.002 0.569 _VSIYDSK(gl)R_
NPM1 Phosphorylation S4 -0.102 0.205 _(ac)MEDS(ph)MDMDMSPLRPQNYLFGCELK_
NPM1 Phosphorylation S10 0.493 0.606 _(ac)MEDSMDM(ox)DM(ox)S(ph)PLRPQNYLFGCELK_
NPM1 Phosphorylation Y67 0.604 0.383 _TVSLGAGAKDELHIVEAEAMNY(ph)EGSPIKVTLATLK_
NPM1 Phosphorylation S70 0.285 0.333 _TVSLGAGAKDELHIVEAEAMNYEGS(ph)PIK_
NPM1 Phosphorylation T75 0.611 0.229 _DELHIVEAEAMNYEGSPIKVT(ph)LATLK_
NPM1 Phosphorylation T78 0.397 _TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLAT(ph)LK_
NPM1 Phosphorylation S125 0.202 0.017 _CGSGPVHISGQHLVAVEEDAES(ph)EDEEEEDVK_
NPM1 Phosphorylation S139 -0.611 _LLSIS(ph)GKR_
NPM1 Ubiquitylation K141 0.568 1.699 _LLSISGK(gl)R_
NPM1 Ubiquitylation K150 -1.308 0.669 _SAPGGGSK(gl)VPQKK_
NPM1 Ubiquitylation K202 0.335 0.204 _SIRDTPAK(gl)NAQK_
NPM1 Phosphorylation S227 0.788 _SKGQES(ph)FKK_
NPM1 Phosphorylation S243 -0.070 0.063 _GPSS(ph)VEDIK_
NPM1 Ubiquitylation K248 0.294 1.847 _GPSSVEDIK(gl)AK_
NPM1 Ubiquitylation K250 0.931 1.267 _AK(gl)MQASIEK_
NPM1 Phosphorylation S254 -0.677 0.371 _MQAS(ph)IEK_
NPM1 Ubiquitylation K257 0.236 0.753 _MQASIEK(gl)GGSLPK_
NPM1 Phosphorylation S260 -0.202 0.203 _GGS(ph)LPKVEAK_
NPM1 Ubiquitylation K267 0.954 1.794 _VEAK(gl)FINYVK_


© Copyright Svejstrup Laboratory 2015