Results for the Category
regulation of intracellular estrogen receptor signaling pathway
(GO:0033146)
RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
W | |||||||
Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
---|---|---|---|---|---|---|---|---|
CARM1 | 0 | -0.160 | 0.540 | -0.032 | ||||
SRC | 0 | 0.050 | 0.470 | -0.031 |
Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
---|---|---|---|---|---|
SRC | Phosphorylation | S17 | -0.604 | -0.689 | _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_ |
SRC | Phosphorylation | S75 | 0.060 | 0.331 | _LFGGFNSSDTVTS(ph)PQR_ |
.
© Copyright Svejstrup Laboratory 2015