bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
positive regulation of chromatin silencing
(GO:0031937)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SIRT1 0 0.910 -0.910
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410
MIER1 0 0.440 -0.370 0.768

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_
SIRT1 Phosphorylation S14 -0.369 -0.246 _(ac)ADEAALALQPGGS(ph)PSAAGADR_
SIRT1 Phosphorylation S16 -0.306 -1.665 _(ac)ADEAALALQPGGS(ph)PS(ph)AAGADREAASSPAGEPLR_
SIRT1 Phosphorylation S26 -1.047 -0.245 _EAAS(ph)SPAGEPLR_
SIRT1 Phosphorylation S27 0.351 -0.363 _EAASS(ph)PAGEPLR_
SIRT1 Phosphorylation S47 -0.574 -0.607 _S(ph)PGEPGGAAPER_
SIRT1 Ubiquitylation K238 -1.641 _RK(gl)DINTIEDAVK_
SIRT1 Ubiquitylation K499 -2.138 -0.204 _LGGEYAK(gl)LCCNPVK_
SIRT1 Ubiquitylation K578 -2.782 _GCMEEK(gl)PQEVQTSR_
SIRT1 Ubiquitylation K601 -3.051 _NVESIAEQMENPDLK(gl)NVGSSTGEK_


© Copyright Svejstrup Laboratory 2015