Results for the Category
negative regulation of mitochondrial depolarization
(GO:0051902)
| RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
| W | |||||||
| Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
|---|---|---|---|---|---|---|---|---|
| BCL2 | 0 | 0.910 | -0.740 | |||||
| SRC | 0 | 0.050 | 0.470 | -0.031 |
| Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
|---|---|---|---|---|---|
| BCL2 | Ubiquitylation | K22 | 1.480 | _YIHYK(gl)LSQR_ | |
| SRC | Phosphorylation | S17 | -0.604 | -0.689 | _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_ |
| SRC | Phosphorylation | S75 | 0.060 | 0.331 | _LFGGFNSSDTVTS(ph)PQR_ |
.
© Copyright Svejstrup Laboratory 2015