Results for the Category
negative regulation of peptidyl-tyrosine phosphorylation
(GO:0050732)
| RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
| W | |||||||
| Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
|---|---|---|---|---|---|---|---|---|
| PRKCZ | 0 | -0.290 | 0.310 | |||||
| DMTN | 0 | 0.810 | -0.530 | |||||
| PRKCD | 0 | 0.250 | 0.070 | 0.578 | 0.427 | |||
| SEMA4D | 0 | -0.540 | 0.790 | |||||
| SEMA4D | 0 | 0.260 | -0.350 |
| Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
|---|---|---|---|---|---|
| DMTN | Phosphorylation | S26 | 0.446 | 0.434 | _DSSVPGS(ph)PSSIVAK_ |
| DMTN | Phosphorylation | S29 | 0.762 | _DSSVPGSPSS(ph)IVAK_ | |
| DMTN | Phosphorylation | S92 | -0.084 | _STS(ph)PPPS(ph)PEVWADSR_ | |
| DMTN | Phosphorylation | S96 | 0.117 | -0.084 | _STS(ph)PPPS(ph)PEVWADSR_ |
| PRKCD | Ubiquitylation | K138 | -0.141 | _SEDEAK(gl)FPTMNR_ | |
| PRKCD | Ubiquitylation | K222 | 0.185 | 0.658 | _DTIFQK(gl)ER_ |
| PRKCD | Phosphorylation | S302 | -0.240 | -0.222 | _S(ph)DSASSEPVGIYQGFEK_ |
| PRKCD | Phosphorylation | S304 | 0.378 | 0.289 | _RSDS(ph)ASSEPVGIYQGFEK_ |
| PRKCD | Phosphorylation | S506 | -0.213 | 0.200 | _AS(ph)TFCGTPDYIAPEILQGLK_ |
| PRKCD | Phosphorylation | T507 | -0.149 | 0.240 | _AS(ph)TFCGTPDYIAPEILQGLK_ |
| PRKCD | Ubiquitylation | K641 | -2.000 | _DYSNFDQEFLNEK(gl)AR_ | |
| PRKCD | Phosphorylation | S645 | 0.577 | 0.832 | _ARLS(ph)YSDK_ |
| PRKCD | Phosphorylation | S647 | 0.886 | 0.853 | _ARLSYS(ph)DK_ |
| PRKCZ | Phosphorylation | T560 | -0.884 | -1.578 | _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_ |
| SEMA4D | Ubiquitylation | K784 | 0.913 | 1.205 | _SALLIGKK(gl)_ |
| SEMA4D | Ubiquitylation | K857 | 0.832 | _DKPFDVK(gl)CELK_ |
.
© Copyright Svejstrup Laboratory 2015