Results for the Category
establishment of planar polarity
(GO:0001736)
| RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
| W | |||||||
| Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
|---|---|---|---|---|---|---|---|---|
| DLG3 | 2 | 0.180 | -1.120 | 1.552 | 0.102 | 0.488 | ||
| DLG3 | 2 | 0.180 | -1.120 | |||||
| PTK7 | 0 | -0.240 | 0.340 | -0.232 | 0.174 | |||
| WNT5A | 0 | |||||||
| VANGL2 | 0 | -1.030 | 1.450 |
| Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
|---|---|---|---|---|---|
| DLG3 | Phosphorylation | S102 | -1.455 | _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_ | |
| DLG3 | Phosphorylation | T115 | -0.707 | -1.378 | _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_ |
| DLG3 | Phosphorylation | S122 | -1.073 | _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_ | |
| DLG3 | Phosphorylation | S158 | 0.773 | _NLSEIENVHGFVSHSHIS(ph)PIK_ | |
| DLG3 | Ubiquitylation | K321 | 1.264 | 1.435 | _IMEIK(gl)LIK_ |
| DLG3 | Ubiquitylation | K361 | 0.180 | _IIEGGAAHK(gl)DGK_ | |
| DLG3 | Ubiquitylation | K368 | 1.043 | 1.755 | _IIEGGAAQK(gl)DGR_ |
| DLG3 | Ubiquitylation | K452 | -0.704 | _YSPVSK(gl)AVLGDDEITREPR_ | |
| DLG3 | Ubiquitylation | K556 | 0.105 | _FEAK(gl)IHDLR_ | |
| DLG3 | Phosphorylation | S573 | 0.697 | _EQM(ox)M(ox)NSSISSGS(ph)GSLR_ | |
| DLG3 | Phosphorylation | S575 | 0.255 | 0.729 | _EQMMNSSISSGSGS(ph)LR_ |
| DLG3 | Ubiquitylation | K843 | 1.259 | _SMENIMEMNK(gl)R_ | |
| PTK7 | Ubiquitylation | K843 | 0.757 | 0.315 | _SLQSK(gl)DEQQQLDFRR_ |
| PTK7 | Ubiquitylation | K906 | 0.519 | -0.411 | _LK(gl)SQPLSTK_ |
| VANGL2 | Ubiquitylation | K379 | 0.582 | _LQEEEQK(gl)NPR_ | |
| WNT5A | Ubiquitylation | K268 | -0.304 | _VGDALK(gl)EK_ |
.
© Copyright Svejstrup Laboratory 2015