bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: ZNF462

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
ZNF462 0 2.797 -1.020 2.200
ZNF462 0 2.797 -1.020 2.200 0.346 0.751

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
ZNF462 Phosphorylation S2172 -0.271 -0.229 _VS(ph)PVPLSGAAAGTEQK_
ZNF462 Phosphorylation S688 -0.284 -0.394 _LANDFPLDLS(ph)PVKK_
ZNF462 Phosphorylation S2169 -0.287 -0.553 _NNS(ph)RVSPVPLSGAAAGTEQK_
ZNF462 Phosphorylation S1451 -1.215 -1.993 _DAVEKPILSSEELAGPVNCENSIPTPFPEQEAECPEDARLS(ph)PEK_

Background Information for ZNF462:


Pubmed-ZNF462 »
Uniprot-ZNF462 »
Biogrid-ZNF462 »
ProteomicsDB-ZNF462 »

Tumorportal-ZNF462 »
COSMIC-ZNF462 »
GenomeRNAi-ZNF462 »
Genecards-ZNF462


Protein-protein Interactions for ZNF462
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait ZNF462 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in ZNF462
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members Znf_C2H2-like IPR015880 1.29
Category members Znf_C2H2 IPR007087 0.92


Protein complexes (CORUM database) featuring ZNF462
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring ZNF462
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0006325 chromatin organization Database 5.02
Category members GO Category GO:0003677 DNA binding Database 1.53
Category members GO Category GO:0006351 transcription, DNA-templated Database 1.07
Category members GO Category GO:0003676 nucleic acid binding Database 0.83
Category members GO Category GO:0045944 positive regulation of transcription from RNA polymerase II promoter Database 0.13
Category members GO Category GO:0043392 negative regulation of DNA binding Database 0.01
Category members GO Category GO:0046872 metal ion binding Database 0


.

© Copyright Svejstrup Laboratory 2015