bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: TPD52L2

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
TPD52L2 0 2.542 0.290 -0.640

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
TPD52L2 Phosphorylation S189 0.791 1.040 _NSATFKS(ph)FEDR_
TPD52L2 Phosphorylation S3 0.564 _(ac)M(ox)DS(ph)AGQDINLNSPNKGLLSDSMTDVPVDTGVAAR_
TPD52L2 Phosphorylation S21 -0.947 0.055 _GLLSDS(ph)MTDVPVDTGVAAR_
TPD52L2 Phosphorylation S12 -0.161 0.038 _(ac)MDSAGQDINLNS(ph)PNK_
TPD52L2 Ubiquitylation K119 0.711 _TQETLSQAGQK(gl)TSAALSTVGSAISR_

Background Information for TPD52L2:


Pubmed-TPD52L2 »
Uniprot-TPD52L2 »
Biogrid-TPD52L2 »
ProteomicsDB-TPD52L2 »

Tumorportal-TPD52L2 »
COSMIC-TPD52L2 »
GenomeRNAi-TPD52L2 »
Genecards-TPD52L2


Protein-protein Interactions for TPD52L2
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait GABPB1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait MRPS2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TPD52L2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in TPD52L2
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members TPD52 IPR007327 0.47


Protein complexes (CORUM database) featuring TPD52L2
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring TPD52L2
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0048471 perinuclear region of cytoplasm Database 0.39
Category members GO Category GO:0046982 protein heterodimerization activity Database 0.28
Category members GO Category GO:0042127 regulation of cell proliferation Database 0.06
Category members GO Category GO:0042803 protein homodimerization activity Database 0


.

© Copyright Svejstrup Laboratory 2015