bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: KIF2A

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
KIF2A 0 -0.137 -0.420 0.020 -0.253 0.239
KIF2A 0 -0.137 -0.420 0.020 0.734 0.174 0.455

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
KIF2A Ubiquitylation K508 0.586 -0.575 _ASK(gl)LTQVLR_
KIF2A Phosphorylation S100 -0.916 -0.833 _TVAS(ph)IKNDPPSR_
KIF2A Phosphorylation S624 -0.943 _ELTVDPTAAGDVRPIMHHPPNQIDDLETQWGVGSS(ph)PQR_
KIF2A Phosphorylation T78 -2.127 -2.294 _GKEIDLESIFSLNPDLVPDEEIEPSPET(ph)PPPPASSAK_
KIF2A Ubiquitylation K391 0.817 _VLEDGK(gl)QQVQVVGLQER_

Background Information for KIF2A:


Pubmed-KIF2A »
Uniprot-KIF2A »
Biogrid-KIF2A »
ProteomicsDB-KIF2A »

Tumorportal-KIF2A »
COSMIC-KIF2A »
GenomeRNAi-KIF2A »
Genecards-KIF2A


Protein-protein Interactions for KIF2A
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait CEP170 Cat. description Hein, Mann, Cell 2015
Category members IP bait ILK Cat. description Hein, Mann, Cell 2015
Category members IP bait KIF2A Cat. description Hein, Mann, Cell 2015
Category members IP bait KIF2C Cat. description Hein, Mann, Cell 2015
Category members IP bait LTN1 Cat. description Hein, Mann, Cell 2015
Category members IP bait RPL35 Cat. description Hein, Mann, Cell 2015
Category members IP bait SKA1 Cat. description Hein, Mann, Cell 2015
Category members IP bait TSNAX Cat. description Hein, Mann, Cell 2015
Category members IP bait TTK Cat. description Hein, Mann, Cell 2015
Category members IP bait FGB Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait KBTBD7 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TSNAX Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TYW3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in KIF2A
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members P-loop_NTPase IPR027417 2.83
Category members Kinesin_motor_dom IPR001752 0


Protein complexes (CORUM database) featuring KIF2A
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring KIF2A
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005829 cytosol Database INF
Category members Pathway Pathway_320 REACTOME_CELL_CYCLE 0 11.08
Category members GO Category GO:0000278 mitotic cell cycle Database 10.63
Category members GO Category GO:0005524 ATP binding Database 5.54
Category members Pathway Pathway_321 REACTOME_MITOTIC_M_M_G1_PHASES 0 5.47
Category members Pathway Pathway_323 REACTOME_DNA_REPLICATION 0 5.24
Category members Pathway Pathway_317 REACTOME_CELL_CYCLE_MITOTIC 0 4.82
Category members Pathway Pathway_621 REACTOME_ADAPTIVE_IMMUNE_SYSTEM 0 4.72
Category members Pathway Pathway_458 REACTOME_IMMUNE_SYSTEM 0 3
Category members Pathway Pathway_726 REACTOME_MITOTIC_PROMETAPHASE 0 2.41
Category members GO Category GO:0007067 mitosis Database 2.23
Category members GO Category GO:0008017 microtubule binding Database 0.79
Category members GO Category GO:0007018 microtubule-based movement Database 0.75
Category members GO Category GO:0005813 centrosome Database 0.75
Category members GO Category GO:0005876 spindle microtubule Database 0.68
Category members Pathway Pathway_1265 REACTOME_MHC_CLASS_II_ANTIGEN_PRESENTATION 0 0.6
Category members GO Category GO:0003777 microtubule motor activity Database 0.49
Category members GO Category GO:0007052 mitotic spindle organization Database 0.41
Category members Pathway Pathway_53 REACTOME_HEMOSTASIS 0 0.4
Category members GO Category GO:0007596 blood coagulation Database 0.4
Category members GO Category GO:0000922 spindle pole Database 0.35
Category members Pathway Pathway_1314 REACTOME_KINESINS 0 0.32
Category members GO Category GO:0005871 kinesin complex Database 0.27
Category members GO Category GO:0003774 motor activity Database 0.2
Category members Pathway Pathway_1028 PID_PLK1_PATHWAY 0 0.16
Category members GO Category GO:0019886 antigen processing and presentation of exogenous peptide antigen via MHC class II Database 0.13
Category members Pathway Pathway_385 REACTOME_FACTORS_INVOLVED_IN_MEGAKARYOCYTE_DEVELOPMENT_AND_PLATELET_PRODUCTION 0 0.07
Category members GO Category GO:0030154 cell differentiation Database 0.06
Category members GO Category GO:0007399 nervous system development Database 0


.

© Copyright Svejstrup Laboratory 2015