bioLOGIC Data
Query: KIAA1191
RNAi screen result | RNAPII IP (PI) | CSB IP | CSB IP (PI) | Chrom. | Chrom. (PI) | Phosphorylation | Ubiquitylation |
W | |||||||
[Click on the plots to view the data selection in the respective scatterplot]
Protein Results:
Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screenGene name | Point score | Z-score sums | RNAi high | RNAi low | RNAPII-IP (PI) | CSB-IP | CSB-IP (PI) | Chrom. | Chrom. (PI) |
---|---|---|---|---|---|---|---|---|---|
KIAA1191 | 0 | -1.514 | 0.460 | -0.790 |
PTM Sites:
Back to Protein Results | Red/green: hit at lower/upper end of the respective screenGene name | PTM type | PTM site | UV | UV (PI) | Sequence |
---|---|---|---|---|---|
KIAA1191 | Phosphorylation | S32 | -1.514 | _AVS(ph)YDDTLEDPAPMTPPPSDMGSVPWKPVIPER_ |