bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: KIAA1191

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
KIAA1191 0 -1.514 0.460 -0.790

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
KIAA1191 Phosphorylation S32 -1.514 _AVS(ph)YDDTLEDPAPMTPPPSDMGSVPWKPVIPER_

Background Information for KIAA1191:


Pubmed-KIAA1191 »
Uniprot-KIAA1191 »
Biogrid-KIAA1191 »
ProteomicsDB-KIAA1191 »

Tumorportal-KIAA1191 »
COSMIC-KIAA1191 »
GenomeRNAi-KIAA1191 »
Genecards-KIAA1191


Protein-protein Interactions for KIAA1191
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait HUWE1 Cat. description Hein, Mann, Cell 2015
Category members IP bait MSH6 Cat. description Hein, Mann, Cell 2015
Category members IP bait NUPL1 Cat. description Hein, Mann, Cell 2015
Category members IP bait RAP1B Cat. description Hein, Mann, Cell 2015
Category members IP bait SMC1A Cat. description Hein, Mann, Cell 2015
Category members IP bait SORT1 Cat. description Hein, Mann, Cell 2015
Category members IP bait TERF2IP Cat. description Hein, Mann, Cell 2015
Category members IP bait VPS16 Cat. description Hein, Mann, Cell 2015
Category members IP bait CLPB Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait KIAA1191 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in KIAA1191
Domain name Domain Description TC-NER relevance -log10(p-value)


Protein complexes (CORUM database) featuring KIAA1191
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring KIAA1191
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members DDR Literature pubmedid:19647519 Paulsen et al., 2009 siRNA screen for g-H2A.x phosphorylation 3.6
Category members GO Category GO:0003674 molecular_function Database 0.08
Category members GO Category GO:0005575 cellular_component Database 0
Category members GO Category GO:0008150 biological_process Database 0
Category members GO Category GO:0016491 oxidoreductase activity Database 0


.

© Copyright Svejstrup Laboratory 2015