bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Data

bioLOGIC Data


Exact search

Query: HNRNPUL2-BSCL2

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
HNRNPUL2-B 2 5.291 0.085 -1.107 -0.540 0.103 0.230

PTM Sites:

Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
HNRNPUL2-BSCL2 Ubiquitylation K471 0.689 1.500 _TQWALK(gl)YAK_
HNRNPUL2-BSCL2 Ubiquitylation K289 1.108 0.996 _STYGVTK(gl)GK_
HNRNPUL2-BSCL2 Phosphorylation T165 0.868 0.829 _SGDET(ph)PGSEVPGDK_
HNRNPUL2-BSCL2 Phosphorylation S168 0.664 _REEDEPEERSGDETPGS(ph)EVPGDK_
HNRNPUL2-BSCL2 Phosphorylation S185 0.569 0.131 _AAEEQGDDQDS(ph)EKSKPAGSDGER_
HNRNPUL2-BSCL2 Phosphorylation S161 -0.150 -0.373 _S(ph)GDETPGSEVPGDK_
HNRNPUL2-BSCL2 Phosphorylation S226 -0.420 -0.594 _S(ph)KSPLPPEEEAKDEEEDQTLVNLDTYTSDLHFQVSK_
HNRNPUL2-BSCL2 Phosphorylation S228 -0.450 -0.953 _SKS(ph)PLPPEEEAKDEEEDQTLVNLDTYTSDLHFQVSK_
HNRNPUL2-BSCL2 Ubiquitylation K291 0.616 _GK(gl)VCFEAK_
HNRNPUL2-BSCL2 Ubiquitylation K305 0.763 _VTQNLPMK(gl)EGCTEVSLLR_
HNRNPUL2-BSCL2 Ubiquitylation K553 1.676 _LLLFK(gl)TFSR_
HNRNPUL2-BSCL2 Ubiquitylation K638 -0.355 _KLLPPSEK(gl)R_

Background Information for HNRNPUL2-BSCL2:





Protein-protein Interactions for HNRNPUL2-BSCL2

Show screen data for Category Name and Description Link to cat description Data Source


Protein Domains in HNRNPUL2-BSCL2

Domain name Domain Description TC-NER relevance -log10(p-value)
Category members P-loop_NTPase IPR027417 2.83
Category members SAP_dom IPR003034 1.96
Category members Zeta_toxin_domain IPR010488 0.33
Category members Chromatin_KTI12 IPR013641 0.09
Category members B30.2/SPRY IPR001870 0
Category members SPRY_dom IPR003877 0
Category members ConA-like_lec_gl_sf IPR008985 0


Protein complexes (CORUM database) featuring HNRNPUL2-BSCL2

Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring HNRNPUL2-BSCL2

Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005524 ATP binding Database 5.54
Category members GO Category GO:0003676 nucleic acid binding Database 0.83
Category members GO Category GO:0016301 kinase activity Database 0.23


© Copyright Svejstrup Laboratory 2015