bioLOGIC Data

Query: HNRNPUL2

[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:
Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen

Gene name	Point score	Z-score sums	RNAi high	RNAi low	RNAPII-IP (PI)	CSB-IP	CSB-IP (PI)	Chrom.	Chrom. (PI)
HNRNPUL2	2	5.291			0.085	-1.107	-0.540	0.103	0.230

PTM Sites:
Back to Protein Results | Red/green: hit at lower/upper end of the respective screen

Gene name	PTM type	PTM site	UV	UV (PI)	Sequence
HNRNPUL2	Ubiquitylation	K471	0.689	1.500	_TQWALK(gl)YAK_
HNRNPUL2	Ubiquitylation	K289	1.108	0.996	_STYGVTK(gl)GK_
HNRNPUL2	Phosphorylation	T165	0.868	0.829	_SGDET(ph)PGSEVPGDK_
HNRNPUL2	Phosphorylation	S168		0.664	_REEDEPEERSGDETPGS(ph)EVPGDK_
HNRNPUL2	Phosphorylation	S185	0.569	0.131	_AAEEQGDDQDS(ph)EKSKPAGSDGER_
HNRNPUL2	Phosphorylation	S161	-0.150	-0.373	_S(ph)GDETPGSEVPGDK_
HNRNPUL2	Phosphorylation	S226	-0.420	-0.594	_S(ph)KSPLPPEEEAKDEEEDQTLVNLDTYTSDLHFQVSK_
HNRNPUL2	Phosphorylation	S228	-0.450	-0.953	_SKS(ph)PLPPEEEAKDEEEDQTLVNLDTYTSDLHFQVSK_
HNRNPUL2	Ubiquitylation	K291	0.616		_GK(gl)VCFEAK_
HNRNPUL2	Ubiquitylation	K305	0.763		_VTQNLPMK(gl)EGCTEVSLLR_
HNRNPUL2	Ubiquitylation	K553	1.676		_LLLFK(gl)TFSR_
HNRNPUL2	Ubiquitylation	K638	-0.355		_KLLPPSEK(gl)R_

ProteomicsDB-HNRNPUL2 »

Show screen data for	Category Name and Description	Link to cat description	Data Source
Category members	IP bait APOBEC3D	Cat. description	BioPlex, Huttlin, Gygi, Cell 2015
Category members	IP bait CRYAB	Cat. description	BioPlex, Huttlin, Gygi, Cell 2015
Category members	IP bait ELAVL2	Cat. description	BioPlex, Huttlin, Gygi, Cell 2015
Category members	IP bait FAM136A	Cat. description	BioPlex, Huttlin, Gygi, Cell 2015
Category members	IP bait FBXW11	Cat. description	BioPlex, Huttlin, Gygi, Cell 2015
Category members	IP bait PRMT8	Cat. description	BioPlex, Huttlin, Gygi, Cell 2015

Show screen data for

Category Name and Description

Link to cat description

Data Source

Category members